KEGG   Xylella fastidiosa 9a5c: XF_0226
Entry
XF_0226           CDS       T00033                                 

Definition
(GenBank) protein-export membrane protein
  KO
K03074  preprotein translocase subunit SecF
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
xfa03060  Protein export
xfa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    XF_0226
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XF_0226
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xfa02044]
    XF_0226
Secretion system [BR:xfa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   XF_0226
SSDB
Motif
Pfam: SecD_SecF Sec_GG DUF5518 ACR_tran
Other DBs
NCBI-ProteinID: AAF83039
UniProt: Q9PGS2
Position
234900..235865
AA seq 321 aa
MKLFPLHLIPNDTKIDFMRWRQLTLMLMSILFAISVLVVVFKGFNYALEFTGGTLVRTQF
AKPVDADQVRQRLEVGGLGNAQVQSVGGGNELLIRLQPYAEHNNDDVAKNAAEAVRKVIT
LPGNPATVQPGEFVGPQVGKDLAMNGVYATIFMLLGFLIYIGFRFEWKFAVAASLTAFFD
LILTIAYMSLLGREFDLTVLAGLLSVMGFAINDIIVVFDRVRENFRSLRVEPLEVLNRSI
NQTLSRTVITAVMFFLSAFALYLYGGRSMEGLAETHMAGAVIVVVSSVVMAVPLLTIGPL
KVSKQDLLPKAKDLESLERRP
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaaactgttcccgctgcatctcattccgaacgacaccaagatcgactttatgcgctgg
cgtcaactgacgttgatgttgatgtcgatactttttgcaatatcagtcttggttgtcgtt
tttaagggatttaactatgcgctggaatttaccggcggcacgctagtgcgtactcagttc
gcaaagcctgtggatgccgatcaggtgcgtcagcggctggaggttggtggtttagggaat
gcacaggtacagagcgtcggggggggtaacgagttgctgattcgcctgcagccgtatgcc
gaacataataatgatgatgtggccaaaaacgctgccgaagcggtgcgcaaggtgattacg
ttgccgggtaatccggcaaccgtacagcctggggaattcgttggtccacaggtgggcaaa
gatctcgcgatgaatggtgtatacgcaacgatctttatgctgttgggttttttgatttat
atcgggtttcggtttgagtggaagtttgcggtcgcagccagtctaacggcgttcttcgat
ctgattttgacgatcgcttatatgtcgctgcttggtcgggagttcgatttgactgttctg
gctggcttgttgtctgtgatgggttttgcgatcaatgacatcattgtggtgtttgaccgt
gtgcgcgagaacttccgtagcctgcgtgtggagccgttagaggtgttgaatcgttcgatc
aatcagacgctatctcgtacggtgattacggcggtcatgttctttctgtcggcgtttgcg
ttgtacttgtacggcggtcgctcgatggaggggttggctgaaacccatatggctggtgcg
gtgattgtcgtcgtgtcttcagtggtgatggcagtgccattgttaaccattggcccttta
aaggtcagtaagcaagatttgctgccgaaggcgaaagacctggagtcactggagcgccgt
ccttaa

DBGET integrated database retrieval system