KEGG   Xylella fastidiosa 9a5c: XF_0549Help
Entry
XF_0549           CDS       T00033                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
xfa00450  Selenocompound metabolism
xfa00970  Aminoacyl-tRNA biosynthesis
xfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XF_0549
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XF_0549
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xfa01007]
    XF_0549
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xfa03016]
    XF_0549
Enzymes [BR:xfa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XF_0549
Amino acid related enzymes [BR:xfa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XF_0549
Transfer RNA biogenesis [BR:xfa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XF_0549
 Prokaryotic type
   Other AARSs
    XF_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AAF83359
UniProt: Q9PFV8
Position
complement(535409..537517)
Genome map
AA seq 702 aa AA seqDB search
MPYSHPLVPLSFMTTALVTTALPYANGPLHLGHLVGYIQADIWVRARRLGGHNTWFVCAD
DTHGTPIMLAAEKAGMPPEAFIATTQASHERDFAAFNVAFDHYDSTHSPVNRHLTEQSYL
TLKQAGHITCRSVAQFYDPAKGMFLPDRYVKGTCPNCGATDQYGDNCEACGATYDPTELK
NPYSVISGTTPELRDSEHFFFEVAHFDTFLRHWLSGDVALPSVKNKLKEWLDAKGGLRPW
DISRDAPYFGFEIPNQPGKYFYVWLDAPIGYLCSFKTLCTRIGEDFDTHLRSGTTTELHH
FIGKDIVNFHALFWPAVLHGTGHRAPTRLHVNGYLTVDGAKMSKSRGTFIMARTYLDAGL
EPDALRYYFAAKSSGDVDDLDLNLSDFVARVNADLVGKLVNLASRCASFIGTRFNGQLAD
TLPDRIQYDQFVAALTPIRDAYERNDTASAIRQTMQLADEANKYIDETKPWIIAKQHNAD
AQLHAVCTQGLNLFRVLITALKPILPHTSIQAETFLAAPVTAWQDVNQPLIGGHTIHPYS
PLFTRIDKKVIEVMINASKDTLAPPPASAKQQNASMSNTAPPPTAEKPETTAPTIGIDDF
AKLDLRIGKVLVCEYVEGSDKLLRFELDAGPLGKRQIFSGIRASYSNPETLIGRNVVFIA
NLAPRKMRFGISQGMILSAGFDSGTLALLDADSSAQPGMPVR
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgccatactcgcaccccctggtaccactctccttcatgaccacagcacttgtcaccacc
gccctgccttacgccaatggtccactgcacctcggccatctggtcggctacattcaagct
gacatctgggtacgcgcacggcgcctgggaggacacaacacctggtttgtttgcgccgac
gacacccacggcaccccgatcatgctggccgcagaaaaagcgggcatgccgccggaagcc
tttatcgccaccacccaagccagccatgaacgcgactttgcggccttcaacgtcgccttt
gaccactacgactccacacattcccccgtcaaccgccacctgaccgaacagtcttacctc
acactcaaacaggccggacatatcacatgccgctcggtcgcccaattttacgacccggcc
aaaggcatgttcctccccgaccgctacgtcaaaggaacctgtccaaactgcggcgcaacc
gaccaatatggcgacaactgcgaagcatgcggtgccacctatgaccccacagaactcaaa
aacccatactcggtgatctccggcacaaccccagaactgcgcgactcagaacacttcttt
tttgaagtggcccacttcgacaccttcctacgccattggctgagcggcgatgtcgccttg
cctagcgtcaaaaacaaactcaaagaatggctagatgccaaaggcggcctacgcccctgg
gacatctcccgcgatgccccctacttcggcttcgaaatcccaaaccagccaggcaagtac
ttctacgtgtggctggatgcaccgatcggctacttatgcagcttcaaaaccttatgcaca
cgcattggcgaagacttcgacacacacctacgcagcggcaccacgacagaattgcatcat
tttatcgggaaagacatcgtcaacttccacgccctgttttggccggcagtgctgcacggc
accggccaccgcgcccccacccggctccatgtcaacggctacctgactgtggacggtgcc
aaaatgtccaaatcgcgcggcaccttcatcatggcgcgcacctaccttgatgctggcttg
gaaccagacgcactacgctactacttcgccgccaaatcctccggagacgtcgacgacctg
gaccttaacctgagtgacttcgttgcacgcgtcaacgctgacctagtcggtaaactcgtc
aacctagccagccgctgcgcaagtttcattggcacgcgttttaacggacaactcgccgac
accctgccagaccgcatccaatatgatcaattcgttgcagcactgacccccatccgtgac
gcttacgaacgcaacgacaccgccagcgcgatccgtcaaaccatgcagctagctgacgaa
gccaacaaatacattgacgagaccaaaccctggatcatcgccaaacaacacaatgccgac
gcacagctacacgccgtctgcacacaaggattgaacctgtttcgcgtcctgatcaccgca
ctcaaaccaatcctgccgcacaccagcatccaagcggagacattcctcgctgcaccagtg
acggcatggcaagacgtcaaccaaccactgatcggtggccacaccatccacccctactcc
cccttattcacccgcatcgataaaaaagtcattgaagtgatgatcaacgcctccaaagac
accctcgcccctccccctgcttcggccaaacaacaaaacgcatccatgtcaaacacagca
ccaccacccactgcggaaaaaccggaaacaactgctcccaccattggtattgacgacttc
gccaaactcgatctacgcatcggcaaagtactcgtgtgcgaatacgttgaagggtcagac
aaactactgcgctttgaattggatgctggccccctgggcaagcgccagatcttctcagga
atacgcgccagctacagcaacccagagacacttattggccgcaacgtcgtgttcatcgcc
aacctagcaccccgcaaaatgcgctttgggatcagccaagggatgatcctctcagccggc
ttcgacagcggtacgctggcactgctagatgctgacagcagcgcccaacccggcatgccg
gtgcgttaa

DBGET integrated database retrieval system