KEGG   Xylella fastidiosa 9a5c: XF_1267Help
Entry
XF_1267           CDS       T00033                                 

Definition
(GenBank) 1,4-beta-cellobiosidase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
xfa00500  Starch and sucrose metabolism
xfa01100  Metabolic pathways
xfa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XF_1267
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XF_1267
Enzymes [BR:xfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     XF_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2
Motif
Other DBs
NCBI-ProteinID: AAF84076
UniProt: Q9PDW2
Position
complement(1222318..1224369)
Genome map
AA seq 683 aa AA seqDB search
MSVSLLAGSLFSTPDVHAEAHVDNPFVDATSYLNPDYSKDIDTSIAKVNDVSLKEKMQTI
KNYPTGVWLDTIDAVKGGPKNPGRLNLTGHLDAALAQKKGNTPITATFVIYDIPGRDCHA
LASNGELPLTPEGLQRYKREYIDTIASIFSNPKYKDIRIVNIIEPDSLPNIITNMSTPSC
AQAKNTGIYEEGIKYALNKLSEIPNVYNYMDIGHSGWLGWDTNRIPAVSLYTKVIQSTTA
GFASVNGFATNTANTTPLIEPNLPNPDLNIGGQPIRSSKFYEWNRYFDEMDYSETLYNDF
VAAGWPSSIGFIIDTGRNGWGGPERPTSAFGNDVNSYVNSGRIDRRNHRGNWCNQKDAGI
GLPPIATPGGHVDAFQWIKPPGYSDGSSSLIPNDQGKGFDRYCDPTFTTPDGVLTGALPD
APLSGDWFHAQFVKLINNAYPDISRTPLPGSGSSSSSGSSSSSGSSSSSGSSSSSGSSSS
SGSSSSSGSSSSSGSSSSSGSSSSSGSSSSSGSSSSSGSSSSSGSSSSSGSSSSSGSSSS
SGSSSSSGSSSSSGSSSSSGSSSGSSSGSGFNPGAGFNPGAGFNPGAGFNPGAGSDPTKN
PITSSITVDSDWHTGYCERVKVTNTGSSRSSWTVTIPLKGTIQTLWSATWSLSGSDKLIA
SGLDWNKTLEPNGTTEFGFCANY
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttcactattagcgggaagtttattttcaactccagatgttcacgctgaagct
catgtcgataacccctttgttgacgcaacctcctatctgaatccagattattcaaaagac
attgatacttccattgcgaaagtcaacgatgtgtcattaaaagaaaaaatgcaaaccatt
aagaattaccctacaggagtttggcttgatacgattgatgcagtaaaaggtggtccgaaa
aatccaggacgtcttaatctcacaggccatctagacgctgcattagcacagaaaaaagga
aatacgcctattacagcaacctttgttatttatgacatacctggacgcgattgccacgca
ttagcttccaatggtgaattacctttaaccccagaaggtctgcaacgttataaaagagaa
tatattgatacgattgccagtattttttcaaatccaaaatataaagatatccgcattgtc
aatattattgaaccggatagcttgccaaatattatcaccaacatgagtactcctagttgt
gctcaagcaaaaaataccggaatttacgaagaaggcataaaatatgcgcttaataaactt
tctgaaattccaaatgtatacaattacatggacatcggccactctggctggctaggatgg
gatactaaccggataccagcagtctctttgtacaccaaggtcattcaaagcactacagca
ggttttgctagtgtcaatggttttgccaccaacacagcaaacactacaccgttgattgaa
ccaaacctaccaaatcctgatctaaatatcggtggacagcctattagatcctctaaattc
tacgaatggaatcgttattttgacgaaatggattattcagaaactttgtataacgatttt
gtcgctgctggctggccatccagtatcggattcatcattgatactggacgtaacggatgg
ggtggacctgaacgcccaacgtccgctttcggaaacgatgttaatagttatgtgaattct
ggacgtatagaccgtcgtaatcaccgtggtaattggtgtaatcagaaagatgcagggata
ggtttacctccaattgcaactccaggtggtcatgtggatgctttccaatggattaaaccc
ccaggttactccgatggttccagctcactgattcctaacgatcaaggtaaaggctttgac
cggtactgtgatcctacatttacaacaccagatggtgtgctaacaggtgcattacctgac
gctccactctctggtgactggttccatgctcaatttgtaaaattaatcaacaacgcttat
cccgatatcagtcgcactccactccccggctccggttctagttccagctccggttctagt
tccagctccggttctagttccagctccggttctagttccagctccggttctagttccagc
tccggttctagttccagctccggttctagttccagctccggttctagttccagctccggt
tctagttccagctccggttctagttccagctccggttctagttccagctccggttctagt
tccagctccggttctagttccagctccggttctagttccagctccggttctagttccagc
tccggttctagttccagctccggttctagctccagctccggttctagctccagctccggt
tctagctccggttctagctccggttctggttttaaccctggtgctggttttaaccctggt
gctggttttaaccctggtgctggttttaaccctggtgctggctccgatccaactaaaaac
ccgattacttctagtatcaccgtggacagcgattggcatactggctactgcgaacgtgtc
aaggtgactaataccggcagcagtcgcagcagctggacagtgacgattccactcaagggg
acgatccaaaccctatggagtgcgacgtggtcactgagtggtagtgacaagctcatcgct
tctggtctggactggaataagacgcttgaaccgaacggcacaacagaattcggtttctgt
gcaaactattga

DBGET integrated database retrieval system