KEGG   Xylella fastidiosa 9a5c: XF_2302Help
Entry
XF_2302           CDS       T00033                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
xfa00860  Porphyrin and chlorophyll metabolism
xfa01100  Metabolic pathways
xfa01110  Biosynthesis of secondary metabolites
xfa01120  Microbial metabolism in diverse environments
Module
xfa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XF_2302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xfa01007]
    XF_2302
Enzymes [BR:xfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     XF_2302
Amino acid related enzymes [BR:xfa01007]
 Aminotransferase (transaminase)
  Class III
   XF_2302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AAF85101
UniProt: Q9PB43
Position
complement(2187092..2188426)
Genome map
AA seq 444 aa AA seqDB search
MNHSRSHTLFVQAQTRIPGGVNSPVRAFRSVGGEPFFVARADGPYLFDVDGHRYIDYVGS
WGPMIVGHNHPAVREAVQVAISNGLSYGAPCAAEVTMAETIARLVPSCDMVRMVNSGTEA
TLSAIRLARGATGRNHIVKFEGCYHGHGDSFLVKGGSGMLTLGMPSSPGVPAELSKLTIT
LTYNDFDAATALFEEMGHHIAAVIVEPVIGNANCIPPRPGYLQHLRTLCTQYAVLLIFDE
VMTGFRVALGGAQALYGVTPDLTTFGKIIGGGMPVGAYGGCRDLMQHIAPAGPIYQAGTL
SGNPVAMAAGLAMLELIQAPDFYTHLSNAAAALCTGLQQAASQAGIAMTTQQIGGMFGLF
FTDQQVETYAQATACNTDRFNRFFHAMLQRGVFFAPSAYEAGFISSAHSPDIIEATLEAA
RAAFQTIANEAAILSESEAPLKMP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattcccgctctcataccctctttgtccaggcgcaaacacgcatccctggtggc
gttaactcgccagtccgtgcgttccgctcggttggcggggagccgttcttcgttgcacgt
gccgatggcccgtatctgtttgacgtcgacggccaccgctacattgattatgtcggctcc
tgggggccgatgatcgtcggtcacaaccacccagcggtgcgtgaggcggtgcaagtggcg
attagcaacggcctgtcctacggtgccccatgtgccgccgaggtgaccatggcagaaacc
attgcgcggctcgtgccctcctgcgacatggtccgcatggtcaactctggcactgaggcc
acattgtcagcaatccgactggcacgcggcgccactggacgcaatcacatcgtgaaattc
gaaggctgttaccacggccacggcgactcattcctagtcaaaggtggcagcggcatgctg
acccttggcatgccaagttcaccaggggtgcctgccgagctgagcaaactaacaatcacg
ttgacttacaacgatttcgatgcggccacggcactgtttgaggagatgggacaccacatc
gcggccgtcattgttgaacctgtcatcggcaacgccaactgcattccgccgcgaccaggc
tatctgcaacatttacgcaccctgtgcacccagtacgcagtgctgttgatctttgatgaa
gtcatgaccggctttcgcgtcgcacttggcggcgcgcaagcgctgtacggggtgacaccg
gacctgaccaccttcggtaagatcatcggtggcggcatgccggtcggtgcgtatggcggt
tgccgcgatctgatgcaacacattgccccagccggtccaatctatcaggcaggcaccctc
tcgggtaatccagtggcaatggcggctggtttggccatgctggaactaatacaggctccg
gatttctatacgcatctcagcaacgccgccgcagccctgtgtaccggtttgcaacaagca
gccagccaggcaggcattgcaatgaccacacaacagattgggggtatgttcggactgttt
tttaccgatcaacaggtggaaacctatgcccaagcgaccgcctgcaatactgaccgcttc
aaccgcttcttccacgcgatgctgcaacgcggcgtgttttttgccccatcagcgtatgaa
gcaggatttatctccagtgcgcattcaccagacatcatagaggccacgttggaagccgcg
cgtgcagcgttccaaacaatcgccaacgaagcagcgatcctgagtgaatcagaagcaccg
ctgaaaatgccatga

DBGET integrated database retrieval system