KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_00065Help
Entry
XFLM_00065        CDS       T01979                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Brite
KEGG Orthology (KO) [BR:xff00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XFLM_00065 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 N_BRCA1_IG LTD
Motif
Other DBs
NCBI-ProteinID: ADN62043
Position
18260..18643
Genome map
AA seq 127 aa AA seqDB search
MENNPSSKIEVAVSSRFLDQQSNRNEGRYVFAYTIRIYNAGNVPARLIARHWQITDANGK
VEYVTGEGVIGEQPRLRPGEEFRYTSGVVLGTEQGQMQGHYDMMADDGTEFTATISPFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaatcccagttcaaagattgaggtcgctgtctcgtcccgcttcctcgaccag
caatctaatcgtaatgaaggccgctacgtcttcgcctacaccatccggatctacaatgct
ggaaatgtccctgcacgactgatcgcgcgccactggcagattaccgatgcaaacggcaaa
gtcgaatacgtcactggtgaaggagtcattggagaacaaccacggctgcgtcccggcgaa
gaatttcgctacacctctggggtcgtgttgggaaccgaacagggccagatgcaaggacat
tacgacatgatggccgatgacggtaccgaattcaccgccacaatctccccattcgtactc
agtgtgccgcgaacactacactga

DBGET integrated database retrieval system