KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_05845Help
Entry
XFLM_05845        CDS       T01979                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Brite
KEGG Orthology (KO) [BR:xff00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XFLM_05845
Enzymes [BR:xff01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     XFLM_05845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADN63108
Position
complement(1266048..1266863)
Genome map
AA seq 271 aa AA seqDB search
MTKTILITGATSGFGRAAVHRFANAGWRVIATGRRIERLEALAAEWPPGHIHITAFDMRD
SATLHTAIQTLPADFADIDVLVNNAGLALGTAPAQHADLAQWREMIDTNITSLVTLTHHV
LPTLIERKGTIINISSVAATYPYTGGNVYAGTKAFVKQFSLGLRSDLHGTGVRVTSIEPG
MAETEFTLVRTGGNQAASDALYRGAHPITAEDIAEQIFYVATLPPHLNINRLEIMPVNQS
FAGFQVARQQQSQLITPPHTLPTHSSGTSDK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaccatattgatcacaggagccacatccggcttcggcagagccgccgtgcat
cgcttcgccaacgccggctggcgtgtcatcgccacaggacgccgcattgagcgcctggaa
gcactcgccgccgaatggcctcctggacacatccacatcaccgccttcgatatgcgggat
agcgccacactacacaccgcgattcaaacgctaccagcagactttgccgacatcgacgtc
ctggtcaacaacgctggtctggcactgggcaccgcaccagcacaacacgccgacctggca
cagtggcgggagatgatcgacaccaacatcacctcattggtgaccttaacccaccacgtc
ctaccgacactgatcgaacgcaaaggcacgatcatcaacatcagctccgtcgccgcgacc
tatccctacacaggcggtaatgtttacgctggcacgaaagcatttgtgaaacaattttcc
ctgggcctgcgctcggatctccatggcaccggcgtacgcgtgaccagcatagaaccaggg
atggccgagaccgaattcaccttagtccgtactggcggcaaccaagccgcttccgacgct
ctgtatcgtggcgctcacccgatcacagccgaagatattgccgaacaaatcttctacgtc
gccacactaccaccacatctcaacatcaatcggctagagatcatgcccgttaaccaatcg
ttcgctggcttccaagtcgcacgacaacagcaatcacaattgatcaccccgccccacaca
cttcccactcactccagcggcacatctgacaaatag

DBGET integrated database retrieval system