KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_06155Help
Entry
XFLM_06155        CDS       T01979                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xff01100  Metabolic pathways
xff01110  Biosynthesis of secondary metabolites
xff01130  Biosynthesis of antibiotics
xff01230  Biosynthesis of amino acids
Module
xff_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XFLM_06155 (trpC)
Enzymes [BR:xff01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XFLM_06155 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADN63165
Position
1339659..1340453
Genome map
AA seq 264 aa AA seqDB search
MSNILTKILARKVEEIAERLLHVSQAELVARCADLPTPRGFAAALQATIAHGDPAVIAEI
KKASPSKGVLREDFRPAEIAISYELGGASCLSVLTDVHFFKGHDDYLSQARDACTLPVLR
KDFTIDPYQVYEARVLGADCILLIVAALDDAQLVDLSGLALQLGMDVLVEVHDIDELERA
IQISAPLIGINNRNLSTFNVSLETTLTMKGLVPRDRLLVSESGILTSADVQRLRAAGVNA
FLVGEAFMRAAEPGESLREMFFIT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatactcactaagattcttgcgcggaaggtggaggagattgccgagcgcctt
ttgcatgtctcacaggctgagttggttgcgcgttgtgccgatttgccgacaccccgtggt
tttgctgctgcgttgcaggcgacgattgcgcatggtgacccagcagtgattgctgagatt
aagaaggccagtccttcaaaaggggtgcttcgcgaggattttcgtcctgcagagatcgct
atctcatatgagcttggtggtgctagctgtctatcagtgctgacggacgtgcatttcttc
aagggtcacgatgattatttgagtcaggcgcgtgatgcttgcactcttccggtgttgcgc
aaagatttcacgatagacccgtatcaggtgtatgaggcacgtgtgcttggtgctgattgt
attttgctgattgtcgctgcattggacgatgctcaattggttgatttgtccggcttggca
ttgcaattggggatggatgtgctggttgaggttcacgatattgacgaacttgagcgtgca
atacagatttctgcgccattgattggtatcaacaaccgtaatctgagtaccttcaacgtg
tcattggagacaacgttgacaatgaaagggttagtgccgcgtgatcgtttgctcgtaagt
gagagcggtatccttacctctgccgatgtgcaacggttgcgtgctgcgggtgtgaatgcg
tttcttgttggtgaggcgtttatgcgtgcggctgaacctggtgagtcactcagagagatg
ttcttcatcacgtga

DBGET integrated database retrieval system