KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_07625Help
Entry
XFLM_07625        CDS       T01979                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xff00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    XFLM_07625 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xff03011]
    XFLM_07625 (rplV)
Ribosome [BR:xff03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    XFLM_07625 (rplV)
  Bacteria
    XFLM_07625 (rplV)
  Archaea
    XFLM_07625 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 SNF2_N
Motif
Other DBs
NCBI-ProteinID: ADN63437
Position
1659527..1659868
Genome map
AA seq 113 aa AA seqDB search
MNMEASAILRGARVSPQKARLVAAQVRGLSADSAVNLLRFSSKKAACLIKKVVESAIANA
ENNHGSNIDDLRINTIIVDEGRMLKRFMARAKGRSSRIVKRSSHITVVVGPAK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggaagcgtctgctatattgcgtggtgcacgtgtttctcctcaaaaggctcgt
ttggttgccgctcaagttcgcggtttatctgctgactctgctgttaatctcttgagattt
tcgagtaagaaggccgcctgcttgattaagaaggtggttgagtctgctattgctaatgca
gaaaacaatcacggttctaatattgatgatttgaggatcaataccataatcgttgatgag
ggcagaatgctgaaacgtttcatggcacgtgccaaggggcgtagttctcgtattgttaaa
cgtagtagtcatattaccgtagttgtcggccctgccaagtaa

DBGET integrated database retrieval system