KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_08605Help
Entry
XFLM_08605        CDS       T01979                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff00260  Glycine, serine and threonine metabolism
xff00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xff01100  Metabolic pathways
xff01110  Biosynthesis of secondary metabolites
xff01130  Biosynthesis of antibiotics
xff01230  Biosynthesis of amino acids
Module
xff_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XFLM_08605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XFLM_08605
Enzymes [BR:xff01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XFLM_08605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADN63615
Position
1871036..1872253
Genome map
AA seq 405 aa AA seqDB search
MSDITVANYHAFPDARGHFGRYGGRFVAETLIGPLQELAQAYDAARHDPDFIAAYNKDLK
DYVGRPSPIYHAERLSRKVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIQRQQINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTHVGHTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMIEDYGRLPDAMTA
CVGGGSNAIGLFHAFLNDASVRIYGAEAAGDGIATGRHAASIVAGRPGVLHGNRTYVVCD
DDGQILETHSVSAGLDYPGVGPEHAFLADSGRVQYVGIRDEEALAAFHLLAHTEGILAAL
ESSHAVAHTMTLARDLPKDALVLCNLSGRGDKDVHTIAAREGVRV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatattactgttgctaactatcatgctttccctgatgctcgcggccattttggg
cgttacggtggtcgttttgttgctgaaacgttgatcggaccgttgcaggagcttgcacag
gcctatgatgcggcgcgccatgatcccgatttcatcgccgcttataacaaggatctcaag
gattatgtgggtcgccccagtccgatctaccatgctgaacggctgagccgtaaggtgggt
ggcgctcaaattctgttgaagcgtgaggatcttaatcacaccggtgcgcacaaaatcaat
aacaccattggccaggccttgctggcagcacgtatgggcaagacacgcatcattgccgag
actggagccggtcagcatggtgtcgccagtgctactgtcgctgcgcgtttgggtttggag
tgtgtggtgtatatgggggctacggatatccagcggcagcagatcaacgtgtatcggatg
aagttgttgggtgcgacggtggtgcccgtgacttccggttcagccacactcaaggatgcg
cttaacgaagcgatgcgtgattgggtgacgcatgtggggcatacgttttatatcattggc
actgttgctggcccagatccgtatccgcgtatggtgcgcgacttcaacgcaattgttggc
cgtgaggcacgtgcgcagatgattgaagattatgggcgtttaccggatgcgatgactgct
tgtgttggcggtgggagtaatgccattggtttgttccatgccttcctcaatgatgcttcg
gtcaggatctatggtgctgaggcggctggagacggcattgcgacgggccgtcacgcggcc
tcaattgttgccggtcgtccgggagtgttgcatgggaatcgcacctacgtggtgtgtgat
gatgatggacagattttggaaacccattctgtatcagccggtttggattatccgggggtt
ggtcctgagcacgcttttttggctgacagtggccgggtgcagtatgtggggattcgggat
gaagaagcgttggctgcattccacttgcttgcacatactgaaggcatcttggctgcattg
gaatccagtcacgctgtggcccataccatgacgttggcgcgcgatcttcccaaagatgca
ttggtactgtgtaacttgtccggtcgcggtgataaggatgtgcacacgatcgcggcgcgc
gaaggtgtacgtgtctga

DBGET integrated database retrieval system