KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_08610Help
Entry
XFLM_08610        CDS       T01979                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff00260  Glycine, serine and threonine metabolism
xff00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xff01100  Metabolic pathways
xff01110  Biosynthesis of secondary metabolites
xff01130  Biosynthesis of antibiotics
xff01230  Biosynthesis of amino acids
Module
xff_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XFLM_08610 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XFLM_08610 (trpA)
Enzymes [BR:xff01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XFLM_08610 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 His_biosynth DUF561 ThiG TMP-TENI PcrB AIRS_C
Motif
Other DBs
NCBI-ProteinID: ADN63616
Position
1872379..1873185
Genome map
AA seq 268 aa AA seqDB search
MHRIDETFRRLRAQSRKALIPFITAGDPSLEAAVPVMHALVRAGADVIELGVPFSDPMAD
GPVIQHSSERALQRGVGLAYVLQTVDVFRQSDAVTPVVLMGYLNPLEIYGIARFTQQALA
SGVDGVLLVDLPPEEADEIRAIFSAAGLALIVLASPTTSASRLATLSGVAQGYLYYVSFA
GVTGADRLDAQSAGDRLRGLRAQTQVPVVVGFGIRDAASAVVMAVDADGVVVGSALVTAL
SDAPDVDTACRRADAFLAPLRQALDAVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtatagacgaaacattccgccgtttaagggcgcaatcgcgcaaggcgttgatc
cctttcatcactgctggcgacccctctttggaggcggctgttccggtgatgcatgctttg
gtccgtgcgggtgcggatgtgattgagttgggtgtgccgttttcggacccgatggcggat
ggtccggtgattcagcacagttccgagcgcgcgttgcagcgtggtgtgggtttggcctat
gtgttgcagacagtcgatgtgttccgtcagagtgatgcagtgacgccggtggtcttgatg
ggctacctcaatcctttggaaatctatggcattgcgcgttttacacagcaggcactggct
tctggagtggatggggtgctgcttgtggatcttcctccggaagaggcggacgagatccgc
gcgatcttttcggcggctggtttggcactcatcgttttggcatctccgacgacctctgcc
tcccgtctggccacgttgagtggggttgcccaggggtacttgtattacgtgagttttgct
ggcgtgactggtgctgatcggcttgatgcgcagtcagccggtgatcgcttgcgtggatta
cgtgcgcagactcaagtcccggtggtggttggctttggtatcagggatgcggccagtgct
gtggtgatggcggtggatgcggatggggtggtggttggcagtgccttggtgacggcctta
agtgatgctccggatgtggacaccgcctgccggcgtgctgatgcgtttttggcaccgttg
cgtcaggcgttggatgcggtgaagtag

DBGET integrated database retrieval system