KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_09765Help
Entry
XFLM_09765        CDS       T01979                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff00790  Folate biosynthesis
xff01100  Metabolic pathways
Module
xff_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XFLM_09765 (folE)
Enzymes [BR:xff01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     XFLM_09765 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADN63836
Position
complement(2134547..2135158)
Genome map
AA seq 203 aa AA seqDB search
MDHSKQQNASITQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDPHD
YLQRTFEEISCYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVES
YARRFQIQEKMTAQIAACIQDTLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTF
REDARTRAEFLQFIEVGTNVIDL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaccattccaaacaacaaaacgcatccatcacccaagctcaggcagaagaggccgta
cgcacacttctacgttgggccggcgaagatcccactcgtgaaggcttgctcgacacacca
cgccgtgtcgttgaagcatacggagattggttcagcggttaccgcgaagatcctcatgac
tacctgcaacgcactttcgaggaaatctcttgctacgacgagatgatcgtactacgtaac
attacctatgaaagccactgcgaacatcacatggcacccatcatcggtaaagttcacgtt
ggctacttgccaaacggcaaagtcgtcggcatcagcaaattagcacgcgttgttgaatcc
tatgcgcgccgcttccagatacaggaaaaaatgactgcgcaaattgcagcatgtatccaa
gacacattgaccccacgtggcgtcggtgtcgtgattgaaggtgcacacgcatgtatgact
acccgaggtatacacaagcgtggtgtatcaatggtcacctcaaagatgctcggcaccttc
cgcgaagacgcacgcacccgcgccgagttcttacagttcatcgaagtaggtaccaacgtg
atcgacttatga

DBGET integrated database retrieval system