KEGG   Xylella fastidiosa Hib4: XFHB_07350Help
Entry
XFHB_07350        CDS       T04925                                 

Definition
(GenBank) vitamin B12 ABC transporter permease
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh00480  Glutathione metabolism
xfh00590  Arachidonic acid metabolism
xfh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    XFHB_07350
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XFHB_07350
Enzymes [BR:xfh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XFHB_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ALR06684
UniProt: A0A1L2B166
Position
complement(1563665..1564243)
Genome map
AA seq 192 aa AA seqDB search
MNMLNVLRFPVLALALAFVSSGVLADAGSLLDLDYRPLAGKETVNLQRLYGGKVLLVVNT
ASKCGFTPQYEGLEALHQKLSPLGFAVLGFPSNDFKGQEPGDEQQIQKFCTLTYGVKFPM
FQKVHVKGDEVTPLYQRLTQTTGVAPGWNFHKYLIARDGHVVAQFDSRTRPDDPILLEAI
KRELAKPVQVAH
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgctcaatgtgttgaggtttcccgttttggctttggctttggcttttgtttct
agtggtgtactggctgatgcggggagtttgctggatttggactaccgtccgttggccggt
aaagagactgtcaatttgcagcgcctttatggtggcaaggtgctgttggtggtcaatacc
gccagtaaatgtggttttaccccgcaatacgaagggttagaggcattgcaccagaaattg
tcgccacttggttttgctgtacttggttttccatccaacgactttaaggggcaagaaccc
ggtgatgagcagcaaattcagaaattctgcacgctgacgtatggggttaagtttccaatg
tttcagaaggttcacgtcaaaggcgatgaggtcacgccactgtatcagcgcttgacgcag
acgacgggtgtggcaccgggctggaacttccacaagtacctcattgcacgtgatggccat
gttgtggctcagtttgatagccgtacgcggcctgatgatccaatcctgttggaagcgatc
aagcgtgagttggcaaagccggtgcaggtagcgcactga

DBGET integrated database retrieval system