KEGG   Xylella fastidiosa Hib4: XFHB_12105Help
Entry
XFHB_12105        CDS       T04925                                 

Definition
(GenBank) histidine kinase
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XFHB_12105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xfh01001]
    XFHB_12105
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:xfh02022]
    XFHB_12105
Enzymes [BR:xfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     XFHB_12105
Protein kinases [BR:xfh01001]
 Histidine kinases
  OmpR family
   XFHB_12105
Two-component system [BR:xfh02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   XFHB_12105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PhoR PAS_8 PAS HATPase_c_2 HATPase_c_5 Latarcin
Motif
Other DBs
NCBI-ProteinID: ALR07468
UniProt: A0A1L2B3J8
Position
complement(2609719..2611083)
Genome map
AA seq 454 aa AA seqDB search
MSIVSTLHRIRFAWFKTLGVLALILFAALLVGLLIGQVWIVLTLTALAEIAWQYWRLHQV
LHQLAVRRRWTRSMDIGVWKELDHLICRNQTDMRARVHRLLEMLRTYRAAAAALPDAVVV
VDCNSQCIQWFNEAANTLLGLRYPSDLDRPVVERLQPLPLASWLTQRCNAESMLDVSSPV
NPDVRLNLHLIPYFDDYLLLIARDVSKLLRLEQVKRDFVANVSHELRTPLTVVHGYLDML
DPDDFPDAAPMLDEMRKQSQRMTQLVEDLLTLSRLESQEELEQEQVAMVPMLATLHREAE
AHSQGRHTIEVIDNAGCDLFGSNKDLHSAFSNLITNAVRYTPAGGSVRVCFQREDDGVVL
MVCDTGYGIPTSHLPRITERFYRVSSSRSRERGGTGLGLSIVKHVLELHQARLDIISEVG
KGSEFSCHFAAARVAMRESESESESESESVPIPP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattgtctccacacttcaccgtattcggttcgcttggttcaagaccctgggggtg
ttggcgctgattttgttcgctgcactgctcgttggtctgttgatcggccaagtgtggata
gtactgaccttaacagccttagcagaaattgcttggcagtactggaggctgcatcaagtt
ctgcatcaattggccgtgcgtcggcgctggacacgttcgatggatatcggtgtttggaaa
gaattagatcacttgatttgccgtaatcaaaccgacatgcgtgcgcgtgttcaccggttg
ctggagatgttgcgtacctaccgcgcagcagctgctgcgctccctgatgcagtggttgtt
gtcgattgcaacagtcagtgcattcaatggttcaatgaggcggcgaataccttgctgggc
ctgcgttatcctagcgacctggacaggcctgttgtcgagcggttgcagccgttgccgtta
gcatcatggttgactcagcgttgtaacgctgagtcgatgttggacgtctcttcaccagtg
aatcctgacgtgcgcttgaatctgcacctcattccttatttcgacgattatttgttgctg
atagcacgtgacgttagcaaactgttgcgtctggagcaggtgaaacgtgactttgtggcg
aatgtgtcgcacgaattacgtaccccactgaccgtggtgcatggttatcttgacatgctc
gatccggatgattttccggatgctgctccaatgttggatgagatgcgtaagcagtcgcag
cgtatgactcaattagttgaggatctgctgacactttccaggttggaatcccaggaggaa
cttgaacaggagcaggtggcaatggtgccgatgttggcgacgttgcatcgtgaggctgag
gcacacagtcaaggccgtcatacgattgaagtgatcgacaatgctggctgcgatcttttc
ggctccaataaggaccttcacagtgcgttttccaatttgattaccaacgcagtgcgttac
actccggctggcggtagcgttagggtgtgcttccaacgcgaagatgatggcgtggtgctg
atggtttgcgacactggttatggcattccaacctcacacttaccacgaatcaccgaacgc
ttttaccgggtttccagcagccgctcgcgtgagagaggggggactggtttagggctgtca
atcgtcaagcatgtgttggaactccaccaggcacgcttagacatcatcagtgaagttggt
aaggggagtgaattctcctgccactttgctgcagcccgtgtcgccatgcgtgaatctgaa
tctgaatctgaatctgaatctgaatctgtgccgataccgccttga

DBGET integrated database retrieval system