KEGG   Xylella fastidiosa MUL0034: P303_10775Help
Entry
P303_10775        CDS       T03317                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
xfl  Xylella fastidiosa MUL0034
Pathway
xfl00051  Fructose and mannose metabolism
xfl00520  Amino sugar and nucleotide sugar metabolism
xfl01100  Metabolic pathways
xfl01110  Biosynthesis of secondary metabolites
xfl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    P303_10775 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    P303_10775 (cpsB)
Enzymes [BR:xfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     P303_10775 (cpsB)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     P303_10775 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 DUF218
Motif
Other DBs
NCBI-ProteinID: AIC13193
UniProt: A0A060HC63
Position
2141962..2143365
Genome map
AA seq 467 aa AA seqDB search
MNDILPVILSGGSGTRLWPLSREAYPKQFLPLVGHHSMLQATWLRAAPVTTHSPIVVANE
EHRFIAAEQLQHLGVYPSAILLEPTGRNTAPAIAVAALEATRTGNDPLLLVLPSDHVIRD
ETAFQTAVHVAAAAAAQGKLVTFGITPNTPEIGYGYIKATGNDTIRPVERFIEKPDLATA
QSYLASGDYFWNSGMFLFRASRYLAELSTFQPAIAEACQRAWSAAKRDTDFIRLDKEAFE
SSPADSIDYAVMEHTADAVAVPLDAGWNDVGSWSALHEVSKQDNDGNAHQGDVIQIDCRN
TYAYGSRLIAMVGLENVVVVETDDALLVGHRDSIQTVKEIVGKIKANGRPEATRHRKVYR
PWGAYDSIDTGQRFQVKRITVKPGGTLSLQMHHHRAEHWIVVSGTAEVTRGSEILLLTEN
QSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIVRFEDTYGRT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatatccttcccgtgatcctatccggcggttctggcacccggctatggccacta
tcgcgcgaagcctatcccaaacagtttctgccactggtcggccaccacagcatgctgcaa
gccacatggctacgcgccgctcccgtgacaacgcattcacccatcgtcgttgccaacgaa
gaacaccgctttattgccgcagaacaactgcagcatttgggcgtgtatccctcagcaatt
ctgcttgaacccacaggccgcaacaccgccccggcaatcgccgtggccgcactggaagca
acacggaccggcaacgatccactgctcctcgtcctaccgtccgaccacgtcatccgtgac
gaaacagcgttccaaactgccgtccatgtggccgccgccgcagccgctcaagggaaattg
gtcacctttggcatcaccccaaacaccccggaaattggctacggctacatcaaagccacc
ggcaacgacacaatacgtcccgttgagcgcttcatcgaaaaacccgatctggccaccgct
caaagctatctggcctccggcgactatttttggaatagcggcatgttcctattccgcgcc
tcacgctacctagcagaactaagcacctttcaaccagcaatcgccgaagcctgccaacgg
gcatggagcgcagcaaagcgcgataccgacttcatccgattagataaagaagcattcgaa
agcagcccagcggattctatagattatgcagtcatggaacacaccgccgacgccgtcgcc
gtgccactagacgccggctggaacgatgtcggctcctggtcggccctacatgaagtctcc
aaacaagataacgacggcaatgcccaccagggcgatgtgatccaaatcgactgccgcaac
acctacgcctatggatcgcgtctgatcgcaatggttggactggaaaacgtggtggtcgta
gaaaccgatgacgccttattagtcggccatcgtgacagcatccagaccgtcaaagagatc
gttggcaaaatcaaagcaaacggacgtcccgaagccacccggcaccgcaaagtctaccgt
ccgtggggggcatacgactccatcgacaccggccaacgcttccaagtcaagcgcatcacc
gtcaagcccggcggcacactcagcctacaaatgcaccatcaccgtgccgaacactggatc
gtggtcagcggcaccgccgaagtcacacgcggcagcgaaatcctattactcaccgaaaat
cagagtacctatatccccctcggcgtcacccaccgcctacgtaacccagggaaactgccg
ctcgaattgattgaagtacagtccggcagctatctcggtgaagatgacatcgtgcgtttt
gaagatacctatggtcgtacttga

DBGET integrated database retrieval system