KEGG   Xylella fastidiosa M12: Xfasm12_1178
Entry
Xfasm12_1178      CDS       T00677                                 
Name
(GenBank) conserved hypothetical protein
Organism
xfm  Xylella fastidiosa M12
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: ACA12129
Position
complement(1246121..1246687)
AA seq 188 aa
MKLTLKNVRLAFPVLFEPKKVNGEGEAAFSACFLIDPADPQVKALNQAIDKMANDKWGVK
AAGQLKQMRMGDRVALHDGDLKASYDGFAGHLYVSARNKSRVLVIDRDRTPLTAQDGRPY
AGCYVNANIELWAQDNNYGKRINASLGGVQFLRDGEAFAGGGVASVEDFEDLSAIAEVMD
VEGAMSWG
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaaactcaccctaaaaaacgtgcgcttagccttccccgtgttgtttgaacccaagaaa
gtcaatggtgaaggtgaggccgccttctcggcctgcttcctcatcgaccctgccgacccg
caagtcaaagcccttaaccaggcgattgacaagatggccaatgacaaatggggcgttaag
gcggcgggccagcttaaacagatgcgtatgggcgacagagtcgccttgcatgatggcgac
ctgaaagccagctatgacgggtttgcagggcacctatacgtctctgcgcgtaacaagtcc
cgggtgctggtgatcgaccgtgaccggaccccgctcaccgcgcaggacggcaggccgtat
gccggatgttacgtcaacgccaacatagaactctgggcgcaggataacaactacggcaag
cggattaacgcctcgctgggtggcgtgcagttcctgcgtgatggcgaggcgttcgctgga
ggcggtgtggccagcgtggaggacttcgaggacctgagcgccattgctgaggtgatggat
gttgaaggagccatgtcgtgggggtga

DBGET integrated database retrieval system