KEGG   Xylella fastidiosa M12: Xfasm12_0182Help
Entry
Xfasm12_0182      CDS       T00677                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xfm01100  Metabolic pathways
xfm01110  Biosynthesis of secondary metabolites
xfm01130  Biosynthesis of antibiotics
xfm01230  Biosynthesis of amino acids
Module
xfm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xfasm12_0182
Enzymes [BR:xfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Xfasm12_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACA11218
UniProt: B0U1P0
Position
218610..219404
Genome map
AA seq 264 aa AA seqDB search
MSNILTKILARKVEEIAERLLHVSQAELVARCADLPTPRGFAAALQATIVHGDPAVIAEI
KKASPSKGVLREDFRPAEIAISYELGGASCLSVLTDVHFFKGHDNYLSQARDACTLPVLR
KDFTIDPYQVYEARVLGADCILLIVAALDDAQLVDLSGLALQLGMDVLVEVHDIDELERA
IQISAPLIGINNRNLSTFNVSLETTLTMKGLVPRDRLLVSESGILTSADVQRLRAAGVNA
FLVGEAFMRAAEPGESLREMFFIT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatcctcactaagattcttgcgcggaaggtggaggagattgccgagcgcctt
ttgcatgtctcacaggctgagttggttgcgcgttgtgccgatttgccgacaccccgtggt
tttgctgctgcgttgcaggcgacgattgtgcatggtgacccagcagtgattgctgagatt
aagaaggccagtccttcaaaaggggtgcttcgcgaggattttcgtcctgcagagatcgct
atctcatatgagcttggtggtgctagctgtctatcagtgctgacggacgtgcatttcttc
aaggggcacgataattatttgagtcaggcgcgtgatgcttgcactcttccggtgttgcgc
aaagatttcacgatagacccgtatcaggtgtatgaggcacgtgtgcttggtgctgattgt
attttgctgattgtcgctgcattggacgatgctcaattggttgatttgtccggcttggca
ttgcaattgggaatggatgtgctggttgaggttcacgatattgacgaacttgagcgtgca
atacagatttctgcgccattgattggtatcaacaaccgtaatctgagtaccttcaacgtg
tcattggagacaacgttgacaatgaaagggttggtgccgcgtgatcgtttgctcgtaagt
gagagcggtatccttacctctgccgatgtacaacggctgcgtgctgcgggtgtgaatgcg
tttcttgttggtgaggcgtttatgcgtgcggctgaacctggtgagtcactcagagagatg
ttcttcatcacgtga

DBGET integrated database retrieval system