KEGG   Xylella fastidiosa M12: Xfasm12_0239Help
Entry
Xfasm12_0239      CDS       T00677                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00010  Glycolysis / Gluconeogenesis
xfm00030  Pentose phosphate pathway
xfm00051  Fructose and mannose metabolism
xfm00052  Galactose metabolism
xfm00680  Methane metabolism
xfm01100  Metabolic pathways
xfm01110  Biosynthesis of secondary metabolites
xfm01120  Microbial metabolism in diverse environments
xfm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_0239
   00030 Pentose phosphate pathway
    Xfasm12_0239
   00051 Fructose and mannose metabolism
    Xfasm12_0239
   00052 Galactose metabolism
    Xfasm12_0239
  Energy metabolism
   00680 Methane metabolism
    Xfasm12_0239
Enzymes [BR:xfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Xfasm12_0239
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Xfasm12_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACA11266
Position
complement(279504..280787)
Genome map
AA seq 427 aa AA seqDB search
MSSPYKSSSHMAKETLLYAQSGGVTAVINATAAAVITEARSHRVKVLAARNGILGALRED
LIDTSKESITAIRALTHTPGGAFGSCRFKLKSLEADHDKYERLLEVFKAHNVRWFLYNGG
NDSADTALKVSQLAKTFDYPLHCIGVPKTIDNDLAITDASPGFGSAAKYTAVSICEAARD
VAAMAETSTKVFIYEAMGRHAGWLAAAAGLAGQGQEEAPHIILLPERTYDETAFLAKVQQ
VVDRVGWCVVVASEGIRSNDGRFVADAGGTTDAFGHTQLGGVAAYLASRVKQALGLKVHW
TLPDYLQRSARHIASKTDWEQAQAVGKAAVRYALEGMNAVMPVIVRTSDTPYRWKIEPAA
LTKIANHEKTLPASFLRRDGFGISERARTYFEPLIRGEAPMPYERNGLPRHVHLKNQSVQ
KRLPAWE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgccctacaagagctcgtcccacatggcaaaagagacgttgttatacgcccaa
tccggcggcgttaccgctgttatcaacgcaaccgccgccgcggtcatcaccgaagcacgg
tcacaccgcgttaaagtcctcgccgcacgcaatggcatcctcggtgcactgcgtgaagac
ctgatcgacacatccaaagaatcaatcacggcaatccgtgccttgacccataccccagga
ggcgcatttggctcgtgccgtttcaagctcaaatcgcttgaagccgatcacgacaagtac
gaacggttacttgaagtattcaaagcacataacgtgcgctggttcctctacaacggtggt
aatgactccgccgatacagcgctcaaagtctcacagttagccaaaacatttgactatcca
ctgcactgtatcggcgtccctaaaaccatcgacaacgatttggcgatcaccgacgccagc
cccggcttcggttcagccgcaaagtacactgctgtctccatatgcgaagccgcgcgggat
gtcgcagcgatggccgagacctcaactaaggttttcatttacgaagcaatgggccgccat
gccggttggctcgctgcggctgctggcttggccggccaagggcaggaagaagccccccac
atcatcctgctccctgaacgcacctacgacgaaacagcatttctggcgaaagtccaacag
gtagtcgaccgggtcggttggtgcgtggtagtcgccagcgaaggtatccgcagcaatgat
gggcgcttcgttgccgatgctggcggcaccactgatgcctttggtcacacgcaacttggc
ggcgtcgccgcttacctcgccagccgagtgaaacaggcactcggactcaaagtgcactgg
acgctgccagattacctacaacgctccgcaaggcacatcgcctccaaaacagactgggaa
caagcacaggctgtgggtaaagctgcagtgcgctacgcactggaaggcatgaatgcagtc
atgcctgtcatcgtacgcacctctgacaccccataccgttggaaaatcgagccggcagca
ctcaccaagattgccaatcacgaaaaaaccttaccagcaagcttcttacgccgtgacggc
ttcggcatcagcgaacgtgcacgcacctactttgaaccattgattcgtggcgaagcaccc
atgccttacgaacgcaacggattaccgcggcacgtccatctgaaaaatcaaagcgtacag
aaacggctacctgcctgggaataa

DBGET integrated database retrieval system