KEGG   Xylella fastidiosa M12: Xfasm12_1325Help
Entry
Xfasm12_1325      CDS       T00677                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00860  Porphyrin and chlorophyll metabolism
xfm01100  Metabolic pathways
xfm01110  Biosynthesis of secondary metabolites
xfm01120  Microbial metabolism in diverse environments
Module
xfm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xfm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Xfasm12_1325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xfm01007]
    Xfasm12_1325
Enzymes [BR:xfm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Xfasm12_1325
Amino acid related enzymes [BR:xfm01007]
 Aminotransferase (transaminase)
  Class III
   Xfasm12_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACA12257
UniProt: B0U328
Position
1383355..1384689
Genome map
AA seq 444 aa AA seqDB search
MNHSRSHALFVQAQTRIPGGVNSPVRAFRSVGGEPFFVARADGPYLFDVDGHRYIDYVGS
WGPMIVGHNHPGVREAVQVAISNGLSYGAPCAAEVTMAETIARLVPSCQMVRMVNSGTEA
TLSAIRLARGATGRNYIVKFEGCYHGHGDSFLVKGGSGMLTLGLPSSPGVPAELSKLTIT
LTYNDFDAATALFEEMGHHIAAVIVEPVIGNANCIPPRPGYLQHLRTLCTQYGVLLIFDE
VMTGFRVALGGAQALYGVTPDLTTFGKIIGGGMPVGAYGGRRDLMQHIAPAGPIYQAGTL
SGNPVAMAAGLAMLELIQAPDFYTHLSNAAAALCTGLQQAASQAGIAMTTQQIGGMFGLF
FTDQQVETYAQATACNTDRFNRFFHAMLQRGVFFAPSAYEAGFISSAHSPNIIEATLEAA
RTAFQTIANEAAILSKSETPIKMR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattcccgctctcatgccctctttgtccaggcccaaacacgcatccctggtggc
gttaattcaccagtccgtgcgttccgctcagttggcggcgaaccgttcttcgttgcacgt
gccgacggcccgtatctgtttgacgtcgacggccaccgctacattgattatgtcggctct
tgggggccgatgatcgtcggccacaaccatccaggggtgcgtgaagcagtgcaagtggcg
attagcaacggcctgtcctacggtgccccatgtgccgccgaggtgaccatggcagaaacc
attgcgcggctcgtgccatcatgccaaatggtgcgcatggtcaactctggcactgaagcc
acattgtcagcgatccgactagcgcgcggtgccactggacgcaattacatcgttaaattc
gaaggctgttaccacggccacggcgactcattcctagtcaaaggcggcagcggcatgctg
acccttggcctaccaagctcaccaggggtgcctgccgagctgagcaaactaacaatcacg
ttgacttacaacgatttcgatgcggccacggcactatttgaggagatgggacaccacatc
gcggccgtcattgttgaacctgtcatcggcaacgccaactgcattccaccgcgaccaggc
tatctacaacatttacgcaccctgtgcacccagtacggagtgctgttgatctttgatgaa
gtcatgaccggctttcgcgtcgcacttggcggcgcgcaagcgctgtacggagtgacaccg
gacctgaccaccttcggtaagatcatcggtggcggcatgccggtcggtgcctatggtggc
cgccgcgatctgatgcaacacattgccccagccggtccaatctatcaggcaggcaccctc
tccggtaacccggtggcaatggcggctggtctggccatgctggagctaatacaggctccg
gatttctatacgcatctgagcaacgccgccgcagccctgtgtaccggtttgcaacaagca
gccagccaggcaggcattgcaatgaccacacaacagattggcggtatgttcggactgttt
tttaccgatcaacaggtggaaacctatgcccaagcgaccgcctgcaatactgaccgcttc
aaccgcttcttccacgcgatgctgcaacgcggcgtgttttttgccccatcagcgtatgaa
gcaggatttatctccagcgcccattcaccaaacatcatagaggccacgttggaagctgcg
cgtacagccttccaaacaatcgccaacgaagcagcgatcctgagtaaatcagaaacacct
ataaaaatgcgatga

DBGET integrated database retrieval system