KEGG   Xylella fastidiosa M12: Xfasm12_1525Help
Entry
Xfasm12_1525      CDS       T00677                                 

Definition
(GenBank) N-acetyl-beta-glucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00520  Amino sugar and nucleotide sugar metabolism
xfm01100  Metabolic pathways
xfm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Xfasm12_1525
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Xfasm12_1525
Enzymes [BR:xfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Xfasm12_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACA12439
UniProt: B0U3L0
Position
complement(1588999..1590006)
Genome map
AA seq 335 aa AA seqDB search
MLLIGVAGTTLSAQEVDWLQDDAVAGVVLFKRNFASRAQIVELSAALREAAPRPLLLAVD
QEGGRVQRFYEGYSALPPLQGIGALYVRDPEAALELAFEHAWLMASEVRASGVDLSFAPV
VDLGRGNRAIGDRAFSDDPHVVAAFAQAYVQGMHAAGMPVTLKHFPGHGSVLEDTHVDLA
VDVRPLETLESEDLVPFAAGIAAGADAVMMAHVVYPNVAPETAGFSAHWIEVILRGRMGF
RGVVFSDDIGMAAVRGVGGVVGCVHAHLDAGCDVVLVCHPELVNDALSAVAGRRSNTAAL
IGLIGRGALGWDGLLADVRYGSIQSRLFERFGTST
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgttactgattggtgtggcgggtacgacgctcagtgctcaggaggtggattggttgcag
gacgatgcggtggccggtgttgtgttgtttaagcgtaattttgcttcacgtgcgcaaatt
gtcgaattatcggctgcgctgcgtgaagctgcgccgcggccgctgttgttggcggttgat
caggagggggggcgtgtgcagcgcttctatgagggctatagtgcgttaccaccattacag
gggattggtgcattgtatgtacgcgatccggaggcggcattggagttggcgttcgaacat
gcttggttgatggccagtgaagttcgagccagtggtgtggatttaagttttgctccggtg
gtcgatcttgggcgtggcaatcgtgcgattggcgatcgtgctttcagtgatgatccgcac
gtggtggcggcgtttgcccaggcctatgtgcaggggatgcatgctgctggtatgccagtg
acgcttaagcattttcctgggcatggtagtgttctggaggatacacacgttgatcttgca
gtggatgtgcgtccgttggaaacgcttgagtctgaggatttggtgccgtttgcggcaggc
attgctgccggtgctgatgcagtgatgatggcacatgtagtttatccaaatgtcgcccct
gaaacggcaggtttttctgcgcattggatcgaggttattttacgtgggcgcatggggttt
cggggggtggttttttccgatgacatcggtatggctgctgtgcgtggcgttggtggtgtt
gttggctgtgtgcacgcgcatcttgatgctggttgtgatgtggttctggtgtgtcatcca
gaattggtgaacgatgcgctatctgctgttgctggccgtcgttccaatacggctgctctt
attggtttgatcggtcgcggtgcgcttggttgggatgggctactggccgatgttcgttat
ggttccattcaatcccgtttatttgaacgattcggaacatccacttga

DBGET integrated database retrieval system