KEGG   Xylella fastidiosa M23: XfasM23_1824
Entry
XfasM23_1824      CDS       T00692                                 
Name
(GenBank) conserved hypothetical protein
Organism
xfn  Xylella fastidiosa M23
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: ACB93227
UniProt: B2I5I7
Position
2028329..2028895
AA seq 188 aa
MKLTLKNVRLAFPVLFEPKKVNGEGEAAFSACFLIDPADPQVKALNQAIDKMANDKWGAK
AAAQLKQMRMGDRVALHDGDLKASYDGFAGHLYVSARNKARPLVIDRDRTPLAAQDGRPY
AGCYVNANIELWAQDNNYGKRINASLGGVQFLRDGEAFAGGGVASVEDFEDLSNVAELED
VEGAMPWG
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaaactcaccctaaaaaacgtgcgcttagccttccccgtgttgtttgaacccaagaaa
gtcaatggcgaaggcgaggccgccttctcggcctgcttcctcatcgaccctgctgacccg
caagtcaaagcccttaaccaggccattgacaagatggccaatgacaaatggggcgctaag
gcggcggcccagcttaaacagatgcgtatgggcgacagagtcgccttgcatgatggcgac
ctgaaagccagctatgacgggtttgcagggcacctatacgtctctgcgcgtaacaaggca
cggccactggtgatcgaccgtgacaggaccccgctcgccgcgcaggacggcaggccgtat
gccggatgctacgtcaacgccaacatagaactctgggcgcaggacaacaactacggcaag
cggattaacgcctcgctggggggcgtgcagttcttgcgtgatggtgaggcgttcgctgga
ggcggtgtggccagcgtggaggacttcgaggacctgagcaacgtcgccgagctggaggat
gttgaaggagccatgccgtgggggtga

DBGET integrated database retrieval system