KEGG   Xylella fastidiosa M23: XfasM23_0160Help
Entry
XfasM23_0160      CDS       T00692                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01130  Biosynthesis of antibiotics
xfn01230  Biosynthesis of amino acids
Module
xfn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XfasM23_0160
Enzymes [BR:xfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XfasM23_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACB91617
UniProt: B2I6S5
Position
219611..220405
Genome map
AA seq 264 aa AA seqDB search
MSNILTKILARKVEEIAERLLHVSQAELVARCADLPTPRGFAAALQATIAHGDPAVIAEI
KKASPSKGVLREDFRPAEIAISYELGGASCLSVLTDVHFFKGHDDYLSQARDACTLPVLR
KDFTIDPYQVYEARVLGADCILLIVAALDDAQLVDLSGLALQLGMDVLVEVHDIDELERA
IQISAPLIGINNRNLSTFNVSLETTLTMKGLVPRDRLLVSESGILTSADVQRLRAAGVNA
FLVGEAFMRAAEPGESLREMFFIT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatactcactaagattcttgcgcggaaggtggaggagattgccgagcgcctt
ttgcatgtctcacaggctgagttggttgcgcgttgtgccgatttgccgacaccccgtggt
tttgctgctgcgttgcaggcgacgattgcgcatggtgacccagcagtgattgctgagatt
aagaaggccagtccttcaaaaggggtgcttcgcgaggattttcgtcctgcagagatcgct
atctcatatgagcttggtggtgctagctgtctatcagtgctgacggacgtgcatttcttc
aagggtcacgatgattatttgagtcaggcgcgtgatgcttgcactcttccggtgttgcgc
aaagatttcacgatagacccgtatcaggtgtatgaggcacgtgtgcttggtgctgattgt
attttgctgattgtcgctgcattggacgatgctcaattggttgatttgtccggcttggca
ttgcaattggggatggatgtgctggttgaggttcacgatattgacgaacttgagcgtgca
atacagatttctgcgccattgattggtatcaacaaccgtaatctgagtaccttcaacgtg
tcattggagacaacgttgacaatgaaagggttagtgccgcgtgatcgtttgctcgtaagt
gagagcggtatccttacctctgccgatgtgcaacggttgcgtgctgcgggtgtgaatgcg
tttcttgttggtgaggcgtttatgcgtgcggctgaacctggtgagtcactcagagagatg
ttcttcatcacgtga

DBGET integrated database retrieval system