KEGG   Xylella fastidiosa M23: XfasM23_0290Help
Entry
XfasM23_0290      CDS       T00692                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00330  Arginine and proline metabolism
xfn00332  Carbapenem biosynthesis
xfn01100  Metabolic pathways
xfn01130  Biosynthesis of antibiotics
xfn01230  Biosynthesis of amino acids
Module
xfn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XfasM23_0290
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XfasM23_0290
Enzymes [BR:xfn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XfasM23_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACB91739
UniProt: B2I7L1
Position
374057..375211
Genome map
AA seq 384 aa AA seqDB search
MTGIPPPSRFPEQPIPPWRRAVLKVGSSLLAADGGGLSPRFALDLAHFVSANITAGRQLV
IVSSGAVAAGRALIPPLPESGGALAARQALAALGQAQLIALWQRFFDRPVAQVLLTHDDL
RNRRRYLNARATLRELLHLGTLPVVNENDTVSVDELKLGDNDNLAAIVAALIDAQALFIA
TDIDGLYTTDPRHHSDAQPLHEVRTLTPENLAMAGDSSSTVGTGGMRTKLEAALKAGAAG
IDTYLFNGRSSDVVRGLAQHRLRGTRIHPTCTPIAARKYWLRHAPVEPGAILIDAGAAAA
LAQQGASLLPGGVLSAEGDFRRGDMIQIATRSPDHPSHPLARGLVQYSAADVRRIAGCHS
RDIQTLLGYTYGDTIVHRDDLVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatccctcccccctcccgcttccccgaacaacccatccccccgtggcgccgc
gccgtcctcaaagtgggtagcagcctcctcgccgccgatggcggcggcctttccccccgc
tttgccttggacttagcacacttcgtctccgccaacatcaccgccggacgccaactcgtc
atcgtctcctctggcgctgtcgccgctggtcgtgccctgatacccccactgcccgaatcc
ggcggcgctctcgccgcccgccaagccttagctgcccttggacaagcacaactcatcgca
ctgtggcaacgcttcttcgaccgccccgttgcccaggtcctcctgacccacgacgacctc
cgcaaccgccgtcgctacctcaacgcacgtgccacattgcgtgaactactgcacctgggc
accttgcctgtcgtcaacgaaaacgacaccgtctccgtcgatgaactcaaactaggcgac
aacgacaacctggcagccattgttgccgcactgattgatgcccaagccctgtttatcgcc
accgatattgacggcttatacaccaccgacccacgccaccattctgacgcacagcccctg
catgaagtccgcaccctgacccctgaaaaccttgccatggctggtgacagcagcagcacc
gttggcaccggcggtatgcgtaccaaacttgaagcagcacttaaagccggcgccgctggc
attgacacctacctatttaacggccgcagcagcgacgttgtccgcggactcgcacaacac
cgcctccgcggcacccgcatccatcccacctgtaccccgattgccgcccgtaaatattgg
ttgcgtcacgccccagtggagcccggcgcgatcctcatcgatgccggtgccgccgctgcc
ttggcacaacaaggcgcttccctacttccgggcggcgttttgagtgccgaaggcgacttc
cgccgcggcgatatgatccagatagccacccgcagcccagatcacccctcccaccccctg
gcacgcggacttgtccaatactcagccgccgatgtccgccgcattgccggttgccattcc
cgcgatattcaaaccctccttggatacacctatggcgacacaatcgttcaccgtgatgac
ctcgtcctcctctga

DBGET integrated database retrieval system