KEGG   Xylella fastidiosa M23: XfasM23_0540Help
Entry
XfasM23_0540      CDS       T00692                                 

Definition
(GenBank) arginase/agmatinase/formiminoglutamase family protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00220  Arginine biosynthesis
xfn00330  Arginine and proline metabolism
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01130  Biosynthesis of antibiotics
xfn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    XfasM23_0540
   00330 Arginine and proline metabolism
    XfasM23_0540
Enzymes [BR:xfn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XfasM23_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase LigB
Motif
Other DBs
NCBI-ProteinID: ACB91984
UniProt: B2I907
Position
638722..639618
Genome map
AA seq 298 aa AA seqDB search
MMKDAMSIVKKKTIRMLFPQWQGGNQELYGLGARLLAWLAPETEAPMFEVNVPEFKKETP
EPERGVIYRQQLFKQYDEAYRLLEREDPDYVVIFGGDCLVDLAPFAWLNEKHHGQLGVLW
IDAHPDIKTPQDSINGHTMVLGSLLGEGDNEFAAKVKVPLKPSRVMFAGLIETGLTEQET
EVIHRLGLNVAKPEVLFDNSQTVIDWVRKEKIEKLVIHFDLDVLHPDVFRSLLFAEPEPE
FDWRATYPVGQLRLAQVIRLIRDVAAETELVAIGITEHLPWDVWHLKESLSKVPLLNR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggacgcaatgagtatagttaagaagaaaacaatcagaatgctgtttcctcaa
tggcaaggtggaaatcaggagctatatggtttgggcgcacgtcttctggcttggttggcg
ccggaaacagaggcgcctatgtttgaggtgaatgtgcctgagtttaaaaaagaaacgccc
gaaccggagagaggggttatctacaggcagcaattattcaagcagtatgatgaagcttat
cgactgttggagcgggaagatccggattatgtggtgatctttggtggtgattgcctggtg
gatttggcgccttttgcttggttgaatgagaaacatcatggtcagttgggtgtgttatgg
attgatgctcatcctgatataaaaacaccacaggattctataaatggtcacacgatggtt
ctgggaagtttgctgggtgaaggtgataacgaatttgccgcaaaggtgaaagttccgctg
aagccgtccagggtgatgtttgcagggttgattgaaacggggttgacggagcaggagact
gaggtaattcatcgccttggactcaatgtggccaaaccggaggtgttatttgacaacagc
cagacggtgattgattgggtccgtaaggagaaaatcgagaagttggtgattcatttcgat
ctggacgttcttcatcctgatgtattccgctcgttgttatttgccgagccggagccggaa
ttcgattggcgggcaacttacccggttgggcaattgcgtttggcacaggtgatcaggttg
attcgcgatgttgccgctgaaacggagttggtggctattggcataactgagcatcttcct
tgggatgtttggcacttgaaggagtctttaagtaaggttccattgctgaatcggtaa

DBGET integrated database retrieval system