KEGG   Xylella fastidiosa M23: XfasM23_0714Help
Entry
XfasM23_0714      CDS       T00692                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00010  Glycolysis / Gluconeogenesis
xfn00052  Galactose metabolism
xfn00500  Starch and sucrose metabolism
xfn00520  Amino sugar and nucleotide sugar metabolism
xfn00521  Streptomycin biosynthesis
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01120  Microbial metabolism in diverse environments
xfn01130  Biosynthesis of antibiotics
xfn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XfasM23_0714
   00052 Galactose metabolism
    XfasM23_0714
   00500 Starch and sucrose metabolism
    XfasM23_0714
   00520 Amino sugar and nucleotide sugar metabolism
    XfasM23_0714
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XfasM23_0714
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XfasM23_0714
Enzymes [BR:xfn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XfasM23_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ACB92155
UniProt: B2I9Z6
Position
complement(842767..843771)
Genome map
AA seq 334 aa AA seqDB search
MIPTPTRDAPNIPSFLAADVGGTHVRVSVVAAAPTCASPPQLFDVRTYRCADYPSLSTIL
NDFLGTRSAVRDCVIASAGFQRSDGTVITTNLPWPLSPHRLRADLNLAEVCLVNDFEALA
YATEDMEPAQLLHLTGPAKAQDGPRLLLGPGTGLGAALWIPNNGRPIVLPTEAGQAALPS
TTELEMQLVRHMLNNRTHVPIEHALSGPGILNVYRALCALQSVLPQHASPDAISHAAAAG
TDMLSSQTLEVFCDFLGSIVGDLVMMYGAQGGVYLAGGILPQLREPLLRSHFVERFLNKG
PMGEALQHVPVRLIEHGQLGIVGAARWYLNKKAT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgattccgacccctacccgagatgcacccaatatcccgtcctttcttgccgccgatgtc
ggcggcactcacgtgcgcgtcagcgtggttgcagccgcgcccacgtgtgctagtccaccg
caactgttcgatgtgcgcacttaccgctgcgctgactatcccagcctcagcacaattctg
aacgacttcctcggtacaagatcagcagtacgtgattgcgtcatcgccagtgccggtttt
cagcgcagcgatggtactgttatcactaccaacctaccgtggccgctatcaccacaccgg
ctacgcgcagatctcaatctggcagaggtctgtctggtcaacgactttgaggcgctggcc
tacgcgacggaggatatggagcctgcgcaattgctgcacctcactggtccagccaaagcg
caggatggaccacgcctgttgctcggtccgggaaccggcctgggtgcagcactctggatt
cccaataacggacgccccattgtcctccccacagaagccggtcaagcagcattgccgagt
acaactgaacttgaaatgcaactggtacgacacatgctgaacaaccgcacacatgtgccg
attgagcatgccttatctgggccaggaatactcaatgtgtaccgcgccttgtgtgcgcta
cagtccgtcctcccccagcacgcgagcccagatgcgatcagtcacgctgcggcagcagga
acagacatgctgtcatcacagactctagaggtgttctgcgacttcctcggcagcatcgtt
ggtgatttggtcatgatgtacggtgcacaggggggtgtctatctggccggaggaatcctg
ccgcagctgcgtgagccgctgctacgcagtcactttgtcgaacgcttcctcaataaaggc
cccatgggtgaggcattacagcacgtcccggtgcggctgatcgaacatgggcaactcggt
atcgtaggtgcggcacgctggtacttaaataagaaagcaacttaa

DBGET integrated database retrieval system