KEGG   Xylella fastidiosa M23: XfasM23_0789Help
Entry
XfasM23_0789      CDS       T00692                                 

Definition
(GenBank) ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn03010  Ribosome
Module
xfn_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    XfasM23_0789
Ribosome [BR:xfn03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    XfasM23_0789
  Bacteria
    XfasM23_0789
  Archaea
    XfasM23_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: ACB92228
UniProt: B2IAE8
Position
complement(935871..936299)
Genome map
AA seq 142 aa AA seqDB search
MTTFTAKNETVQRDWYLVDAEGKTLGRLATELARRLLGKTKPVYTPHVDTGDYLVVINAE
KVVVTGKKLTDKYYHRFTGYVGNLKSESLGQALQRHPERVLEIAVKGMLPKGPLGRAMYR
KLKVYTGSKHPHTAQQPQVLDI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgactacgttcactgcaaaaaacgagaccgtacagcgtgactggtatcttgttgacgcc
gaaggcaagaccctcggtcgccttgcaacagagttggcgcgccgcctactcggcaaaacg
aaacctgtctacactccccatgttgatacaggcgattatcttgtcgtgattaatgccgag
aaggtcgttgttacaggcaaaaaactcactgataagtactaccaccgcttcaccggatat
gtaggcaatcttaagagtgagagcctcggacaagcgctgcaacgccatccggagcgagtg
cttgagatcgcagtcaaaggcatgcttccgaaagggccactaggccgcgctatgtaccgc
aagcttaaagtctacacgggctccaagcatccacacaccgcgcagcagccacaagttctg
gacatataa

DBGET integrated database retrieval system