KEGG   Xylella fastidiosa M23: XfasM23_0871Help
Entry
XfasM23_0871      CDS       T00692                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00790  Folate biosynthesis
xfn01100  Metabolic pathways
Module
xfn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XfasM23_0871
Enzymes [BR:xfn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     XfasM23_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACB92307
UniProt: B2I4L2
Position
complement(1024313..1024924)
Genome map
AA seq 203 aa AA seqDB search
MDHSKQQNASITQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDPHD
YLQRTFEEISCYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVES
YARRFQIQEKMTAQIAACIQDTLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTF
REDARTRAEFLQFIEVGTNVIDL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaccattccaaacaacaaaacgcatccatcacccaagctcaggcagaagaggccgta
cgcacacttctacgttgggccggcgaagatcccactcgtgaaggcttgctcgacacacca
cgccgtgtcgttgaagcatacggagattggttcagcggttaccgcgaagatcctcatgac
tacctgcaacgcactttcgaggaaatctcttgctacgacgagatgatcgtactacgtaac
attacctatgaaagccactgcgaacatcacatggcacccatcatcggtaaagttcacgtt
ggctacttgccaaacggcaaagtcgtcggcatcagcaaattagcacgcgttgttgaatcc
tatgcgcgccgcttccagatacaggaaaaaatgactgcgcaaattgcagcatgtatccaa
gacacattgaccccacgtggcgtcggtgtcgtgattgaaggtgcacacgcatgtatgact
acccgaggtatacacaagcgtggtgtatcaatggtcacctcaaagatgctcggcaccttc
cgcgaagacgcacgcacccgcgccgagttcttacagttcatcgaagtaggtaccaacgtg
atcgacttatga

DBGET integrated database retrieval system