KEGG   Xylella fastidiosa M23: XfasM23_0999Help
Entry
XfasM23_0999      CDS       T00692                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xfn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XfasM23_0999
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xfn01007]
    XfasM23_0999
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xfn03016]
    XfasM23_0999
   03029 Mitochondrial biogenesis [BR:xfn03029]
    XfasM23_0999
Enzymes [BR:xfn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     XfasM23_0999
Amino acid related enzymes [BR:xfn01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   XfasM23_0999
Transfer RNA biogenesis [BR:xfn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XfasM23_0999
 Prokaryotic Type
   Other AARSs
    XfasM23_0999
Mitochondrial biogenesis [BR:xfn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    XfasM23_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: ACB92430
UniProt: B2I4Y5
Position
1153166..1154935
Genome map
AA seq 589 aa AA seqDB search
MRTHFCGLINETLIGHTVTLAGWTDVARNLGGVCFIDLRDHEGIVQITVDSRAIDQNNSE
LFRVASGLSYEDVLQVEGVVHARHAVNDKIKTGKVEVIATKIKILNKAAPLPFHAHENPG
EDIRLKYRYLDLRRPEMQRMQRTRIKLVQALRRHLDMHGFQDIETPILTKATPEGARDFL
VPARMHPGEFYALPQSPQLFKQILMVAGFDRYYQIARCFRDEALRADRQLEFTQLDMEFA
FVSERDVQDFVEEMIRRVFKEVAGIELDTTFPRMTWKEAMRRFGSDKPDMRINLELIDVA
ALVADSTFTPFTNAVAHPNGRVAALRIPRGAVLSRKQIDEYAAYTAKYGATGLAYAKLAP
TGEITSPIAKFFSEDAFAALLSHIGAEKGDIVFFGAGNYNKVSDFMGALRLKAGKDFALI
TADWRPLWVTDFPMFEWDEEAQRYVALHHPFTAPAAINDIDELRTHARTALSRGYDMVLN
GNEIGGGSIRIHRPEMQRAVFELLGITEDEARAKFGFLLDALNYGAPPHGGIAFGIDRIA
ALIAGTESIRDVIPFPKTTGAQCLMTDAPSPISEEQLSEIHVITKKLTP
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccatttctgcggcttgattaatgaaacattgatcggccacaccgttaccctt
gctggctggaccgatgtggcccgtaacctgggtggagtttgctttatcgatttacgtgac
cacgaagggatcgtacaaatcacggtagattcacgtgccatcgaccaaaacaactcagaa
ctgttcagggttgctagtggcttgagttatgaggatgtactacaagttgaaggcgttgtg
cacgcccgtcatgcggtcaacgataagatcaagaccggcaaggtcgaagtgattgctaca
aaaatcaagatactcaataaggctgcacctttaccgttccatgctcacgaaaacccaggc
gaagatatacgtctgaaataccgctacctggatctgcgccgcccggaaatgcagcgtatg
caacgtacgcgtatcaaactggtacaggcactacgtcgccatctggacatgcacggtttc
caagacattgaaacgccaatcctaacgaaagcaacccctgaaggagcccgtgactttctt
gttcccgccagaatgcacccgggcgaattttacgccttaccgcaatcaccacagcttttc
aaacaaatactaatggtggctggtttcgatcgttactatcaaatcgcacgctgtttccgt
gacgaagcattgcgtgcggatcgccaacttgaattcacccaacttgatatggagtttgct
tttgtaagcgaacgtgacgtccaggactttgttgaagagatgattcggagagttttcaaa
gaggtcgccgggatcgagcttgatacaacgttcccccgcatgacatggaaggaagcaatg
cgccgttttggctctgacaaaccggatatgcgcatcaatctagaactgattgatgttgcc
gcactcgttgctgacagcaccttcaccccatttaccaatgccgttgcgcatcccaacggt
cgtgttgccgcattgcgtatccccagaggcgcagtattgtcgcgcaagcaaattgatgaa
tatgccgcctacacagccaagtatggtgccacaggacttgcttacgccaaactcgcccct
acaggcgaaatcacttcgccaatcgctaaatttttttccgaggatgcctttgctgcacta
ctctcacacatcggagcggagaaaggcgacatcgtgtttttcggtgctggaaactacaac
aaagtctccgacttcatgggcgcgttacgcctgaaagccggcaaagatttcgccctaatc
accgcagactggcgcccattgtgggtcaccgactttccaatgtttgagtgggacgaagaa
gcgcagcgttacgttgccttacatcaccccttcactgcaccagcagccattaacgatatt
gacgaattacgcacacacgccaggacagccttgtcccgcggctatgacatggtactcaat
ggcaacgaaattggcggcggctctatccgtattcaccgtccggaaatgcaacgtgcagtc
tttgaactactcggcattactgaagatgaagcacgcgccaaatttggtttcctccttgac
gcactgaattatggtgccccaccacacggagggattgcctttggcattgaccgcatcgcc
gcactgatcgccggcactgaatcaatccgcgatgttattccttttccaaagaccaccggc
gcacaatgcctgatgaccgatgcaccctcccccatctcggaagagcaactctctgagatc
catgtgataacgaagaaactcacgccatga

DBGET integrated database retrieval system