KEGG   Xylella fastidiosa M23: XfasM23_1289Help
Entry
XfasM23_1289      CDS       T00692                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
xfn  Xylella fastidiosa M23
Brite
KEGG Orthology (KO) [BR:xfn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XfasM23_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 N_BRCA1_IG LTD
Motif
Other DBs
NCBI-ProteinID: ACB92710
UniProt: B2I5R5
Position
1420519..1420902
Genome map
AA seq 127 aa AA seqDB search
MENNPSSKIEVAVSSRFLDQQSNRNEGRYVFAYTIRIYNAGNVPARLIARHWQITDANGK
VEYVTGEGVIGEQPRLRPGEEFRYTSGVVLGTEQGQMQGHYDMMADDGTEFTATISPFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaatcccagttcaaagattgaggtcgctgtctcgtcccgcttcctcgaccag
caatctaatcgtaatgaaggccgctacgtcttcgcctacaccatccggatctacaatgct
ggaaatgtccctgcacgactgatcgcgcgccactggcagattaccgatgcaaacggcaaa
gtcgaatacgtcactggtgaaggagtcattggagaacaaccacggctgcgtcccggcgaa
gaatttcgctacacctctggggtcgtgttgggaaccgaacagggccagatgcaaggacat
tacgacatgatggccgatgacggtaccgaattcaccgccacaatctccccattcgtactc
agtgtgccgcgaacactacactga

DBGET integrated database retrieval system