KEGG   Xylella fastidiosa M23: XfasM23_1500
Entry
XfasM23_1500      CDS       T00692                                 

Definition
(GenBank) type I secretion membrane fusion protein, HlyD family
  KO
K11003  hemolysin D
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xfn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XfasM23_1500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xfn02000]
    XfasM23_1500
   02044 Secretion system [BR:xfn02044]
    XfasM23_1500
Transporters [BR:xfn02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   XfasM23_1500
Secretion system [BR:xfn02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   XfasM23_1500
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 DNA_pol3_alpha Biotin_lipoyl TmoB Claudin_3
Other DBs
NCBI-ProteinID: ACB92910
UniProt: B2I6K0
Position
1661987..1663408
AA seq 473 aa
MKHMLQGWRDFLSRYLHVFRAAWSIRAQLEPPHRTTDERTFLPAHLELTETPVSPTACWS
MRIIIACFIVTLLWACFGKIEIVAVAPGKIVVDSRTKVLQPLETAVVRRILVRDGEKVKA
HQALIELDATATGAEYAQAEDALLNATLTALRLRALSTALERGQTPQLTHSATIPADRIA
AEQALTLSQFNAYQAKRHNLQATIAQRRAELRTAQDTIEPLTESARISKMRSADYAILLK
DKYVGRHDYLLREQERITAERDLATQRNRIQEIRSALSAAQEELSVLQADFRQQTLDDLR
KADEQIGQLTPQLAKAKQRNRLMTLRSPVEGIVQQLAIHTVGGVVTPAQQLLAVVPVQET
LEVEATVLNKDIGFLRPEQRVTVKIESFPYTRYGYLTGKIISISHDAAQDEKLGLVFPVR
IRLDNTTLTIDGTQIRMSAGMALSAEIKTGKRTVIDYLLSPLEQYTDEALRER
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaaacacatgctccaaggatggcgcgactttctttcgcgttacctccacgtcttccgt
gccgcctggtcgattcgcgcccaactagaaccacctcaccgcaccaccgatgagcgcacc
ttcctacccgcccatctagaactgaccgaaaccccggtctcccctaccgcatgctggagc
atgcggatcattattgcctgcttcatcgtgaccctactgtgggcctgcttcggcaaaatt
gaaattgttgccgtcgccccggggaaaatcgtcgtcgactcacgcaccaaagtactccaa
ccactagagaccgccgtagtacgccgtatcctggtccgtgatggcgaaaaagtgaaagca
caccaagcactgatcgaacttgatgccaccgccaccggcgccgaatacgcacaagctgaa
gatgccttactcaatgccacattgaccgcattgcgcctgcgcgcactctccaccgcacta
gaacgtggccaaacaccgcaactcacccattcagcaaccatccccgctgatcgcatcgcc
gccgaacaagcactgacactgagccaattcaatgcataccaagccaaacgccacaaccta
caagcaaccattgcccaacgccgcgccgaactacggacagcccaagacaccatcgaacca
ttgaccgaatccgcacgcatctccaaaatgcgctccgccgattacgccatactcctcaaa
gacaaatacgtcggccgtcacgactacctactgcgtgaacaagaacgcatcaccgccgaa
cgcgacttagcaacccaacgcaaccgcatccaagaaatccgctccgccctgagcgcagcc
caagaagaactcagcgtattacaagccgacttccgccaacaaaccctggatgacctacgg
aaagccgacgaacagatcggccaattgacaccacaactggcaaaagccaaacaacgtaat
cgactcatgacactacgctcccccgttgaaggcatcgtccagcaactagccatccacacc
gttggtggcgtcgtgacccccgcacaacaactcctagccgtggtcccagtacaagaaaca
ttagaagtggaagccaccgtcctcaacaaagacatcggatttttacgtcccgaacaacgc
gtcaccgtcaaaattgaaagcttcccctacacccgctacggatacctcaccggcaaaatc
atcagcatctcccatgacgccgcacaagacgaaaaactaggcttagtctttcccgtacgc
atccgtttagacaacaccacactcactattgatggaacacaaatcagaatgagcgcaggc
atggcattaagcgccgaaatcaaaacaggcaaacgcaccgttattgattacttactgagc
cccctagaacaatataccgacgaagcattgcgggaacgataa

DBGET integrated database retrieval system