KEGG   Xylella fastidiosa M23: XfasM23_1744Help
Entry
XfasM23_1744      CDS       T00692                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XfasM23_1744
Enzymes [BR:xfn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XfasM23_1744
DNA repair and recombination proteins [BR:xfn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XfasM23_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD AAA_22 UvrD_C UvrD-helicase T2SSE DUF2075 AAA_28 AAA_16 Herpes_Helicase ATPase DEAD AAA_24 AAA_29 Mg_chelatase TrwB_AAD_bind NTPase_1 Rad17
Motif
Other DBs
NCBI-ProteinID: ACB93148
UniProt: B2I7Y3
Position
complement(1927929..1929848)
Genome map
AA seq 639 aa AA seqDB search
MSLLAALNQAGVLRTLDDALARSLCRLDPKTPDKVAAAAALASMAVAHGHAGVDLAHPGL
LAGEMFDWPSAAEWVHLLRASRWVAEPSEGEAPAPTGQPLVLEQGVLYLRRYREYERRLA
IGLRRIAAARLPPAESAAVATVFAALFPQARAGQDRQALAAALALQRALLLVTGGPGTGK
TTTIARLLLLRVAQARQQGQASLRIALAAPTGRAAERMAESLRAAAGHVSAAGGDAALFA
ALPSGASTVHRLLGVIPDTPRFRHCEDNPLPYDVIVVDEASMMDLPLMCKLVDAVADGTQ
LILLGDPDQLPSVEAGDVLAGILAAAGSGEVLDVADAQVLAPLLGAPSAAVVAECHVVRG
GLHGHRVHLQHSHRQGEDLALAPLAEAVRLGDATAVLGMLRRGTLRGVQFHEGVLDPCVG
AGQVLLAHWRALAALSDPVQALAAAGRLRLLTALREGPQGAAGINARIERLLGGGGVDGY
FHGRLLLMTETSSRQRLFNGDIGVCLRDDDGTMWAWFSGAGGEGVRAFAPAALPAHESAF
AMTVHKAQGSEFDTVWLQLPRQESRVLSRELIYTGLTRARHGLHVAGSESVLCAALARQA
VRVSGLAWRLGVTGCNTVPIGAGAGDAEVFGKGGQGVLF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgccgcgctcaaccaggctggtgtgttgcgtacgttggatgatgcgttg
gcgcggagtttgtgccgtcttgatccgaagactccggacaaggtggccgctgccgctgcg
ctggcctcaatggcggtggcgcatggtcacgcgggtgtagatctggcccatcctggattg
ctcgctggagagatgttcgactggccttccgctgcggagtgggtgcatctgctgcgcgcc
agtcggtgggtggccgagccatctgagggggaggcaccagcaccgacagggcagccgttg
gtgcttgagcaaggggtgctctatctgcgtcgctatcgtgagtatgagcggcgtttagcg
atcggtttgcgtcggattgccgctgcacggttgccaccggctgaatcggccgcggtggcg
acggtgtttgcggcgttgtttccacaggcacgcgctgggcaggatcgtcaggcattggcg
gctgcgttggcgttgcagcgtgcgttattgctggtcacgggggggcctgggactggcaag
acaacgacgattgcgcgcctgttattgctgcgtgtcgcccaggcgcggcaacaggggcag
gcgtcgttacgtattgcgctggccgcgccgacgggccgtgcggccgagcgaatggctgaa
agtctgcgtgcggcggcagggcatgtgtccgcggcggggggggatgcggcgttgtttgcc
gcgttgccgtcgggagcgagtacggtgcatcgtttgcttggggtgatccccgatacgccg
cgctttcgtcattgtgaggacaatccgttgccttatgacgtgatcgtggtggatgaggct
tcaatgatggatctgccgctgatgtgtaagttggtggatgctgtggcggacgggacgcag
ttgattttgctgggtgatccggatcagttgccgtcagtggaggcgggcgatgtgcttgcg
gggattcttgccgctgccggttccggtgaggtgttggatgtcgccgatgcgcaggtattg
gcgcccttgttaggcgcgccgtctgcagcggttgttgcagagtgtcacgttgtccgcggg
gggttacatgggcatcgggtgcatctgcaacacagtcaccgtcagggtgaggatttagcg
ttggcgccgttggctgaggcggtgcgtttgggggatgcgactgcggtgctggggatgttg
cgtcgcggcacacttcgtggggtgcaatttcatgagggggtcttggatccgtgtgtcggg
gctggtcaggtgttgttggcgcattggcgtgcgttggctgcgttgtctgatccggtgcag
gcattggcagcggcggggcgattacgtttgttgacggcgttgcgtgaggggccgcagggg
gcggcggggatcaatgcgcggattgagcgcctgctcggcggcggcggtgtggatggttac
tttcatgggcggctgttgttgatgactgagactagttctcgtcagcgtttgttcaatggt
gatattggggtgtgtcttcgggatgatgatgggacgatgtgggcttggttttctggtgct
gggggagagggtgtccgcgcatttgcaccggctgcgttgccggcgcatgagagtgcgttt
gcgatgacggtgcataaggcgcaggggtcggagttcgatacggtgtggttgcagttgccg
cgtcaggagagtcgggtgctgtcacgggagttgatctatacggggttgactcgtgcacgc
catgggttgcatgtggcgggcagtgagtcggtgttgtgtgcggcgttggcacggcaagcg
gtgcgtgtgtcggggctggcttggcggcttggtgtcactggttgcaacacggtgccaata
ggggcaggtgcgggggatgcggaggtgtttggcaagggggggcaaggggtgttgttctga

DBGET integrated database retrieval system