KEGG   Xylella fastidiosa M23: XfasM23_1953Help
Entry
XfasM23_1953      CDS       T00692                                 

Definition
(GenBank) Cellulase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00500  Starch and sucrose metabolism
xfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XfasM23_1953
Enzymes [BR:xfn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XfasM23_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_2
Motif
Other DBs
NCBI-ProteinID: ACB93352
UniProt: B2I997
Position
2186727..2188571
Genome map
AA seq 614 aa AA seqDB search
MSFSKHFGKLMLATCLSLSAAPAFSYSISHGKVVDDKGNQIQLRGVNWFGFETGDHVVNG
LWARNWKEFITQLQGMGFNAIRLPFCPANLNSNTSPSSIDYSRNPDLQGLSSLQILDKVV
KELSDRRMYVLLDHHRPDCSAISELWYTDSYSEKQWIDDLRFVAHRYANVHGVIGLEVKN
EPHGRTTWGTGDPKTDWNTAVEHAAAAILEAAPKWLIGVEGIGENPICSSTIGHFWGENL
EPMDCTPLKVPADHLLLMPHVYGPDVYVQPYFNSPDFPNNMAAIWDKHFGHFAKAGYAMA
IGEFGGKYGEGDPRDIAWQNAFVDYLISIGVTDAFYWAANQNSVDTGGMVGNDWTTPRDD
KVKLLNKLWNAGGGASGGSGGGAGASSGSGAGGGSSGGAGTGSGSGAGGGSSGGAGTGSG
SGAGGGSSGGAGASSGSGAGGGSSGGAGTGSGSGAGGGSSGGAGASSGSGAGGGSSGGAG
ASSGSGAGGGSSGGAGAGSGSGARGGSSGGAGAGSGSGAGGGSGSGSDPTKSKIAVNTIV
DSDWHTGYCERIQVTNTSDSPNTWTVTIPIKGKIQTLWSARWSVKDNALTAFGMDWNKTL
DPKGRTEFGFCSNY
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttccaaacacttcggcaaactcatgttggccacgtgcctatccttatctgcg
gcaccagcattcagttacagcatcagtcacgggaaggtcgtcgatgacaaaggcaaccaa
atccaattaaggggcgtcaactggtttggttttgaaaccggagatcatgtggtaaatgga
ctatgggcacgtaattggaaagaattcatcacacagctacagggcatgggattcaacgcg
atacgtttaccgttctgcccagccaatctaaatagcaacacatcaccaagcagcattgat
tacagccgcaatccggacttgcaaggcttgagctcgctgcaaatcctggacaaggtcgtc
aaagaattgagcgaccgcagaatgtatgtgctgctagatcaccatcggccggactgctca
gcaatctctgagttgtggtacacggattcatacagcgaaaaacagtggattgatgatcta
cgcttcgtcgcacaccgttacgccaacgtacacggcgtcatcggcttggaggtaaagaat
gaaccacatggcagaaccacctggggcaccggagatccaaaaactgattggaacaccgca
gtcgagcatgcggcagcagcgatcttggaggccgcaccaaaatggctgatcggagtcgag
gggattggagagaatcccatctgctccagcaccattgggcatttttggggcgaaaacctg
gaaccgatggactgtacgccactgaaagtccctgccgaccatttgctattgatgccacac
gtctacgggccagatgtctacgtacagccgtacttcaatagtccggatttcccaaacaac
atggcagcgatctgggataaacacttcggacattttgcgaaagccggctacgcgatggcg
attggtgagttcggtggcaagtacggtgaaggtgatccacgcgatatcgcttggcaaaac
gctttcgtggattacctcatcagtatcggcgtgacggatgccttctattgggcagcaaac
cagaacagcgtcgataccggcggcatggttggcaatgactggaccaccccacgcgatgac
aaggtgaagctgctgaataagctgtggaatgccggtggtggtgccagtggtggttccggc
ggcggtgctggtgctagttccggcagtggtgctggcggcggctccagcggcggtgctggt
actggttccggcagtggtgctggcggcggctccagcggcggtgctggtactggttccggc
agtggtgctggcggcggctccagcggcggtgctggtgctagttccggcagtggtgctggt
ggcggctccagcggcggtgctggtactggttccggcagtggtgctggcggcggctccagc
ggcggtgctggtgctagttccggcagtggtgctggcggcggctccagcggcggtgctggt
gctagttccggcagtggtgctggcggcggctccagcggcggtgctggtgctggttccggc
agtggtgctcgcggcggctccagcggcggtgctggtgctggttccggcagtggtgctggc
ggcggctccggtagcggctccgatcctacaaagagcaagattgctgttaataccatcgta
gacagcgattggcatactggttactgcgagcggatccaagtgacgaataccagcgacagt
ccgaatacctggacggtgacgattccaatcaaggggaagatccagacgctatggagcgcg
cgttggtcagtgaaggataacgcactcaccgcttttggtatggactggaataagacgctt
gatccgaaaggcaggactgaattcgggttctgttcgaactattga

DBGET integrated database retrieval system