KEGG   Xylella fastidiosa M23: XfasM23_2068Help
Entry
XfasM23_2068      CDS       T00692                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xfn  Xylella fastidiosa M23
Brite
Enzymes [BR:xfn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XfasM23_2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_11 Methyltransf_12 Methyltransf_32 MTS Methyltransf_18 CMAS PrmA GCD14
Motif
Other DBs
NCBI-ProteinID: ACB93466
UniProt: B2I9U5
Position
2323518..2324174
Genome map
AA seq 218 aa AA seqDB search
MTIDFSIAREKMVEQQIRPWDVVDLHVLDVLAHIPREAFVPEPYRTLAYADLEIPLPGGQ
TMMKPVIEGRLLQALMLSPEEDVLEIGTGSGFLTACLASLGHEVVSLEINSALAASARTH
LDTIGLGSNVHIEQADAFTWQPERQFSVICLTGAVSTLPLQFLQWLHPNGRMFAIHGHSP
AMQAVLVRGDASTPNITSLFETDLAYLKGGEPALQFHF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgatttttccatagcccgcgaaaaaatggtcgaacagcagatccgtccatgg
gatgtggtggatctgcacgtacttgatgtactggcacacatcccacgcgaggcgttcgtc
cctgaaccataccgtaccctagcctacgcagaccttgaaatccccttacccggcggacaa
acaatgatgaaacccgtcattgaggggcgcctacttcaagccctgatgttgtcaccagaa
gaggacgtattggaaatcggcaccggcagtggtttcctcactgcctgcttggcttcactg
ggacacgaagtagtcagcctagagatcaattccgcactggccgcatcggcacgtacccac
ctagataccattggcctaggcagtaacgtacacattgagcaggccgacgctttcacttgg
caacccgaacgtcagttcagcgtcatttgcttgactggtgcagtgagcacgctgccactg
caatttctgcaatggctacaccccaacggccgtatgttcgctatacacggccactcccca
gcgatgcaagctgttctggtgcgtggagatgcctctaccccaaacatcacatccctgttt
gagaccgatctggcttacctcaaaggtggcgagccagccctccaatttcatttttga

DBGET integrated database retrieval system