KEGG   Xylella fastidiosa M23: XfasM23_2266
Entry
XfasM23_2266      CDS       T00692                                 

Definition
(GenBank) Conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xfn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XfasM23_2266
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xfn02044]
    XfasM23_2266
Secretion system [BR:xfn02044]
 Type IV secretion system
  Trb secretion system protein
   XfasM23_2266
SSDB
Motif
Pfam: TrbC Acyl_transf_3 Trp_oprn_chp
Other DBs
NCBI-ProteinID: ACB93659
UniProt: B2IAS0
Position
pXFAS01:37905..38297
AA seq 130 aa
MQFTKSCINVNYRVLLILCVALLLLIATHPAFASNTSGGGLPSDEWFTRIRASVTGPFAF
TVAIIGIVGAGAGLILGGDMNGFLRTLIFIVLVLSFLVAAQNSLSAITGQGAEITAFSHD
LSNLLQARLA
NT seq 393 nt   +upstreamnt  +downstreamnt
atgcagttcaccaagtcttgtatcaacgttaattatcgagtgcttcttatcctttgcgtt
gcgctactgctgttgattgccacgcatccggcgttcgcgtcaaacacgagtggcggtggt
ctaccttcagatgaatggttcactagaattcgcgcgtctgtgacaggtccgtttgcattt
accgtagcgattattggcatcgttggtgctggtgcagggcttattcttggtggtgacatg
aacggcttcttgcgcacgctcatcttcatcgtcctggtgttgtccttcttggttgccgca
caaaacagcctgagtgcgatcacggggcagggtgctgaaattacggcgttttcgcatgat
ctgagcaatctcttacaagccaggctcgcgtaa

DBGET integrated database retrieval system