KEGG   Xanthomonas fragariae: BER92_07085Help
Entry
BER92_07085       CDS       T04667                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xfr  Xanthomonas fragariae
Pathway
xfr00071  Fatty acid degradation
xfr00072  Synthesis and degradation of ketone bodies
xfr00280  Valine, leucine and isoleucine degradation
xfr00310  Lysine degradation
xfr00362  Benzoate degradation
xfr00380  Tryptophan metabolism
xfr00620  Pyruvate metabolism
xfr00630  Glyoxylate and dicarboxylate metabolism
xfr00640  Propanoate metabolism
xfr00650  Butanoate metabolism
xfr00900  Terpenoid backbone biosynthesis
xfr01100  Metabolic pathways
xfr01110  Biosynthesis of secondary metabolites
xfr01120  Microbial metabolism in diverse environments
xfr01130  Biosynthesis of antibiotics
xfr01200  Carbon metabolism
xfr01212  Fatty acid metabolism
xfr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BER92_07085
   00630 Glyoxylate and dicarboxylate metabolism
    BER92_07085
   00640 Propanoate metabolism
    BER92_07085
   00650 Butanoate metabolism
    BER92_07085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BER92_07085
   00072 Synthesis and degradation of ketone bodies
    BER92_07085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BER92_07085
   00310 Lysine degradation
    BER92_07085
   00380 Tryptophan metabolism
    BER92_07085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BER92_07085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BER92_07085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BER92_07085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xfr04147]
    BER92_07085
Enzymes [BR:xfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BER92_07085
Exosome [BR:xfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BER92_07085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOD14541
UniProt: A0A1Y6H926
Position
complement(1555343..1556518)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGAFLGQFNGVPAPTLAAAAIEGALAQSGIAPADVSEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMFGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGLFGEATAEKFGFSRADQDAFAI
ASVERAQAAQRTGAFADEIVAVTVATRKGKVIVDRDEQPGKSDVAKIPALKPAFKKDGSV
TAASSSSISDGAAITVLMSADDAQRRGVTPLARIVGHVTHSQAPEWFTTAPVAAIQSLVG
KIGWQLDEVNLFEINEAFAVVAMIPIKELGIAHDKVNVHGGACALGHPIGASGARLVVAL
VNALRMRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgtactgccatcggcgcgttcctcggccaa
ttcaacggtgtgccggcgccgacgctcgccgccgccgcaatcgagggcgcgctggcgcaa
tcggggattgcaccggccgacgtttccgaagtcatcgtcggctgtgtgctgccggccaat
ctcggtcaggcacctgcgcgccaggccgcgatcgcggcaggcatccccacctcgaccggc
gccaccaccatcaacaaggtgtgcggctcgggtatgaaggcgatcatgtttggacacgac
ctgatcaaggccggctcagccagcatcgtggttgccggtggcatggaatcgatgagcaat
gcgccgcatctgctgcccaactcgcgcaccggcaaccgttacggcaatttccaggccgtc
gaccacatggcctgggacggcctgaccaatccctacgacggccaggcaatgggcttgttc
ggcgaagccaccgccgaaaaattcggtttcagccgcgccgatcaggatgcgtttgcgatc
gcatcggtggaacgcgcgcaggcagcgcaacgcactggcgcctttgccgacgaaatcgtt
gcggtcacggtagccacgcgcaagggcaaggtcatcgtcgatcgcgatgagcagcccggc
aaatccgacgtggccaagatcccggccttgaaaccggccttcaagaaggacggcagcgtc
accgcagccagttcgtcgagcatctccgatggcgcggcgatcaccgtgctgatgagcgcg
gacgacgcgcaacgccgcggcgtgacgccgttggcgcgcatcgtcgggcatgtcacccac
tcgcaggcccccgagtggttcaccaccgcgccggttgccgcgatccaatcgctggtcggc
aagatcggctggcaactggacgaggtgaatctgttcgaaatcaacgaagcgttcgccgtg
gtggcgatgataccgatcaaggaactaggcatcgcgcacgacaaggtcaacgtgcatggc
ggtgcctgcgcattgggtcatccgatcggcgcatcgggtgcgcgcttggtggtggcattg
gtgaatgcgttgcgcatgcgcggtggcaaacgcggaatcgcgacactatgcatcggtggt
ggcgaagcgactgctattgctatcgagttgatttaa

DBGET integrated database retrieval system