KEGG   Xanthomonas fragariae: BER92_12705Help
Entry
BER92_12705       CDS       T04667                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
xfr  Xanthomonas fragariae
Pathway
xfr00730  Thiamine metabolism
xfr00790  Folate biosynthesis
xfr01100  Metabolic pathways
xfr02020  Two-component system
Module
xfr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BER92_12705
   00790 Folate biosynthesis
    BER92_12705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BER92_12705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xfr04147]
    BER92_12705
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:xfr00537]
    BER92_12705
Enzymes [BR:xfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BER92_12705
Exosome [BR:xfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BER92_12705
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:xfr00537]
 Enzymes
  BER92_12705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AOD15432
Position
2789377..2791083
Genome map
AA seq 568 aa AA seqDB search
MPMRYRLPALVALTTLCVVACASTARTSASAPASVRVEVPQVTHPAGETPQWWYRSSASR
AAGNGAMAGRARNVILFLGDGMSLTTVAAARILDGQRKGGPGEENLLSWEQFPATAFSKT
YNTDSQTPDSAGTMTAITTGVKSHMGAIGVSSGNRSDCADSLGKGLLSWLQLADSAGMAT
GIVTTTRLTHATPAATYAHSPDRNWENDTDLPDAARTAGCQDIAQQLLWTARYGRGPQVV
LGGGRSQFQTVQERDPEYDDKVGLRLDGRDLIAEWKQAHPQGAYVWNEQQLKDAAGAPAL
LGLFQPDHMQFDHDRNRTAQGEPSLTEMTRTAIQSLSRDPNGFALMVEGGRIDHANHAGN
AYRALDETVSLSDAVRTAVQTASPDTLIIVTADHSHTLNFVGYPVRGNPILGKVRGTGGE
EGDRTQLATDLAGQPYTTLSYANGPGHTGASNAQPAGPKKFPHEPSSSEPAAGRPDLTHV
DTEAPSYMQESLVPTKSESHGGEDVGIWATGPGSAAFRGTLEENVIYHVIVQATPRLRER
LCKAGTCDSAGVPVELPKPTTFETATKR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgcgctaccgcctgcctgccctcgtcgccctaaccacgctgtgcgtggtcgcc
tgcgcctccactgccagaaccagcgcctctgcacccgcgtcggtgcgggtagaggtgccg
caggtgacacatcccgctggcgagacgccgcaatggtggtaccgctccagcgcgtcacgt
gcggccggcaatggcgccatggccggccgcgcgcgcaacgtgatcctgtttctgggcgat
gggatgagcctgaccactgtggccgccgcacgcatcctggacggccagcgcaagggcggg
ccgggcgaagagaacctgttgtcatgggaacagtttccggctaccgccttcagcaagact
tacaacaccgattcacagacgccggattcggccggcaccatgaccgccatcaccaccggc
gtgaagtcgcacatgggcgcgatcggcgtcagtagcggcaaccgcagcgactgcgccgac
agcctgggcaaaggtctgttgagctggctgcaactggccgacagcgccggcatggcgacc
gggatcgtcaccaccacccgactcacccacgccaccccggccgcgacctatgcccattcg
ccggaccgcaactgggaaaacgacaccgacctgcccgacgccgcacgcaccgccggctgc
caggacatcgcccagcaattgctctggaccgcgcgttacgggcgcggcccgcaagtggtg
ctaggcggcggacgcagccagttccagaccgtgcaggagcgcgacccggaatacgacgac
aaggtcggcctgcgcctggacggccgcgatctgatcgccgagtggaagcaggcgcacccg
caaggcgcgtatgtatggaacgaacagcaattaaaggacgctgccggtgcgcctgcgttg
ctgggcctgttccagccggatcacatgcagttcgatcacgaccgcaaccgcactgcgcaa
ggcgagcccagcctgaccgagatgacgcgcaccgcgatccagtcgctgtcgcgcgacccg
aacggcttcgcgctcatggtcgaaggcggtcgtatcgaccacgccaaccacgccggcaac
gcctaccgcgcactcgatgaaaccgtctcgctatccgatgcggtgcgcaccgccgtgcag
accgcgtcaccggacacgctgatcatcgtcaccgccgaccattcgcacacgctcaacttc
gtcggctacccggtgcgcggcaacccgatcctgggcaaggtgcgtggcaccggcggcgaa
gaaggcgaccgcacccagctggccaccgatctggccgggcagccctacactacgctgagc
tacgcaaacggccccggtcataccggtgccagcaacgcgcagccggccggcccgaagaaa
ttcccgcacgaacccagcagcagcgaacccgcagccggccgcccggacttgacccatgtc
gacaccgaagcgcccagctacatgcaggaatcgctggtaccgaccaagtccgagagccat
ggcggcgaagacgtgggcatctgggcgacgggcccgggcagcgcggcgttccgcggcacc
ttggaagagaacgtcatttaccacgtcatcgtgcaggccaccccgcgcctgcgcgagcgc
ctgtgcaaggccggcacctgcgacagcgccggcgtgccggtggagttgccgaagccgacc
acgttcgagactgcgaccaagcggtga

DBGET integrated database retrieval system