KEGG   Xanthomonas fragariae: BER92_13930Help
Entry
BER92_13930       CDS       T04667                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
xfr  Xanthomonas fragariae
Pathway
xfr00640  Propanoate metabolism
xfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BER92_13930
Enzymes [BR:xfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BER92_13930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AOD15614
UniProt: A0A1Y6H5E4
Position
complement(3049472..3052120)
Genome map
AA seq 882 aa AA seqDB search
MNSQYRKPLPGTSLDYFDARAAVDALQPGAYAMLPYTARVHAENLVRRAEPQLLEAYLRQ
LIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVPVQLIVDH
SLAVEYAGFDKQAFAKNRSVEDRRNADRFHFIEWTKRAFENMQVIPPGNGIMHQINLEKM
SPVIYTLDGVAFPDTCVGTDSHTPHVDALGVIAVGVGGLEAENVMLGRASWMRLPDIIGV
ELLGRPAPGITATDIVLALTEFLRQQRVVGAYLEFYGAGASALTIGDRATISNMTPEFGA
TAAMFYIDQQTLDYLRLTGREDTQIALVETYARQTGLWADALIYAQYERVLQFDLSSVVR
NMAGPSNPHKRVATTELAARGIAGTWDQVPGQMPDGAVIIAAITSCTNTSNPRNVIAAGL
LARNANARGLTRKPWVKSSLAPGSKAVQLYLEEAGLLSELEQLGFGIVAFACTTCNGMSG
ALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVIAYAIAGTVRFDIE
KDVLGIDADGVAVTLKDLWPTDAQIDAVVARSVKPEHFRSVYDPMFKRSVTQGIGVSPLY
AWRPTSTYIRRPPYWEGALAGARSLRGMRPLAVLGDNITTDHLSPSNAILAGSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPKLVNEMAVVDGQVKAGSLARLEPEGQVLRM
WEAIETYMTRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHRTNLVGMG
VLPLEFKPGSDRKTLGIDGSETFDVAGERTPGATLTLSIHRRNGKQLQVPVTCRLDTAEE
VSIYQAGGVLQRFAQDFLENRESGVGNRELSGATATPRPEMH
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccagtaccgcaagcccctgccgggtacctcgttggattatttcgatgcacgc
gctgccgtggatgcgctgcaacccggcgcctatgcaatgttgccgtacaccgcacgtgtg
catgccgaaaacctggtgcggcgcgcggaaccacaactgttggaagcgtatcttcgccag
ctgatcgagcgtaagcgcgacctggatttcccgtggtttccggcccgtgtggtctgccat
gacattctcgggcagaccgcgttggtcgacttggccggcttgcgtgatgcgatcgccgag
cagggcggcgacccggcgcaggttaacccggtagtgccagtgcagttaatcgtcgatcac
tcgctggcggtggaatatgccggcttcgacaagcaggcttttgccaagaatcgcagtgtg
gaagatcgccgcaacgccgatcgcttccacttcattgaatggaccaagcgtgcgttcgag
aacatgcaagtgattccgccgggcaacgggatcatgcaccagatcaatcttgagaagatg
tcgccggtgatctacaccctcgatggcgtagcgtttcccgatacctgcgtgggcaccgat
agccacacgccgcatgtggatgcgctaggcgtgatcgcggtgggtgtgggtggattggaa
gcggagaatgtgatgctgggccgggcgtcgtggatgcgcttgcccgacattatcggggtg
gaattgttgggccggccagcaccgggcatcacggccaccgacattgtgctggcgttgacc
gagttcctgcgtcagcagcgggtggtcggcgcctatctggagttttatggagccggcgcc
agtgcgctgactatcggcgaccgcgcgaccatctccaacatgacgccggagttcggtgcc
accgcggcgatgttctatatcgatcagcagacgctggactatctgcgcctgaccgggcgc
gaagacacccagattgcattggtggaaacctacgcccgccagaccggcttatgggcggat
gctcttatctacgcgcaatacgagcgcgtgctgcagttcgatctgtctagcgtggtgcgc
aacatggccggtccatccaacccgcacaagcgcgtggccactaccgagctggccgcccgc
ggtattgccggtacctgggaccaggtgccgggacagatgcccgatggcgcggtgatcatc
gcggcgattacttcgtgcaccaacacctccaatccacgcaacgtcattgctgccggcttg
ctggcacgtaatgcgaacgcacgcggattgacccgcaaaccgtgggtgaagagttcgctg
gcgccgggttccaaggctgtgcagttgtatctggaggaagcgggtctgttgagcgagctg
gaacagcttggcttcggcatcgtggcgttcgcatgcaccacctgcaacggcatgagcggt
gcgctggatccggtgatccagcaagagatcatcgatcgcgatctgtatgcaacggcggtg
ttgtcgggtaaccgcaatttcgatgggcggatccatccgtatgccaagcaggcgtttctg
gcatcgccgccattggtgattgcgtatgcgatcgccggcacggtgcgcttcgatatcgaa
aaagatgtgctgggcatcgatgccgatggcgtggcggtgacgctcaaggatctgtggcct
accgatgcgcagattgatgcagtggtggcacgcagcgtcaagccggagcatttccgcagc
gtctacgacccgatgttcaagcgcagcgtgacgcagggcatcggcgtgagccccttgtac
gcttggcgcccgaccagcacctacatccgccgcccgccgtattgggaaggcgcgcttgct
ggcgcacgcagtttgcgtggcatgcggccgttggcggtgttgggcgacaacatcacgacc
gatcatctatcgccgtcgaatgcgattctggcgggcagtgcggccggcgagtatctggcg
aagatgggcctaccggaggaagacttcaactcctacgcaacccatcgcggcgatcacctc
accgcgcagcgcgccaccttcgccaaccccaagctggtcaacgaaatggcggtggtcgat
gggcaagtcaaggccggttcgttggcgcggctggaaccggaaggtcaggtgttgcgcatg
tgggaggcgatcgaaacctacatgacgcgcaagcagccgctgatcatcattgcaggcgcc
gattacggccagggttcttcgcgcgattgggccgccaagggcgtgcgcctggccggtgtg
gaagtgatcgtcgccgaaggcttcgagcggattcaccgtaccaacctggtcggcatgggt
gtgctgccgctggagttcaagccgggcagtgatcgcaagacgctgggcatcgacggcagc
gagaccttcgatgtcgcgggtgaacgcacaccgggcgccacgctgacgttgtcgatccat
cggcgcaacggcaagcagctgcaagtgccggtcacgtgccgcctggatactgccgaagaa
gtgtcgatttaccaagccggcggcgtactgcagcggtttgcgcaggattttttggagaac
cgggagtcgggagtcgggaatcgggagttgtcaggagcaacggcaacaccgagaccggaa
atgcactag

DBGET integrated database retrieval system