KEGG   Xanthomonas fragariae: BER92_18435Help
Entry
BER92_18435       CDS       T04667                                 

Definition
(GenBank) NADP-dependent 3-hydroxy acid dehydrogenase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
xfr  Xanthomonas fragariae
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BER92_18435
Enzymes [BR:xfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     BER92_18435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 NmrA Polysacc_synt_2 Sacchrp_dh_NADP RmlD_sub_bind F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AOD16292
UniProt: A0A1Y6H2V7
Position
4016015..4016770
Genome map
AA seq 251 aa AA seqDB search
MSKTVLITGATSGFGSAAVRRFAAAGWKVTATGRRAERLDALAAELPAGQVHTSAFDMRD
AQALSAAIDALPADFADIDVLVNNAGLALGTTPAQQADLAQWQQMIDTNVTALVTLTHRL
LPALIERRGAIINIASVAATYPYPGGNVYGGTKAFVQQFSLGLRADLHGTGVRVTSIEPG
MAETEFTLVRTGGNQAASDTLYRGATPMTAEDIAEQILYVASLPAHLNINRLEIMPVTQS
FAGFQVARDAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagactgttctgatcaccggtgccacctccggattcggcagtgccgccgtgcgc
cgttttgccgccgccggctggaaggtcaccgccaccggtcgccgcgccgagcgcctggat
gcgctggccgccgaactgcccgcaggccaggtgcacacctccgccttcgacatgcgcgat
gcgcaagctttgtcggcagcgatcgacgccttgccggctgacttcgccgacatcgacgtg
ctggtcaataacgccggcctggcgctgggcaccacgcccgcgcagcaggccgacctggcg
cagtggcagcagatgatcgacaccaacgtcaccgcgctggtcacccttacccatcgcctg
ttacccgcactgatcgaacgccgtggcgcgatcatcaacatcgcctcggtggcggccact
tacccgtaccccggcggcaatgtctacggcggcaccaaggcgttcgtgcaacagttttcg
ctgggcttgcgcgcagacctgcatggcaccggcgtgcgcgtgacctcgatcgagccgggc
atggccgaaaccgaattcactctggtgcgcaccggcggcaaccaggccgcttccgacacg
ctgtaccgcggtgccaccccgatgactgccgaagatatcgccgaacagatcctctacgtc
gccagcctgccggcgcatctgaacatcaatcggctggaaatcatgccggtgacgcagtcg
tttgccggctttcaggtagcccgcgacgcgcagtga

DBGET integrated database retrieval system