KEGG   Xylella fastidiosa subsp. sandyi Ann-1: D934_00480Help
Entry
D934_00480        CDS       T03318                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
xfs  Xylella fastidiosa subsp. sandyi Ann-1
Pathway
xfs00020  Citrate cycle (TCA cycle)
xfs00480  Glutathione metabolism
xfs01100  Metabolic pathways
xfs01110  Biosynthesis of secondary metabolites
xfs01120  Microbial metabolism in diverse environments
xfs01130  Biosynthesis of antibiotics
xfs01200  Carbon metabolism
xfs01210  2-Oxocarboxylic acid metabolism
xfs01230  Biosynthesis of amino acids
Module
xfs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xfs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:xfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D934_00480
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D934_00480
Enzymes [BR:xfs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     D934_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AIC09167
UniProt: A0A060H8B2
Position
complement(115236..117467)
Genome map
AA seq 743 aa AA seqDB search
MSSTPKLIYTLTDEAPFLATQSLLPIIKAYTKVAGIQVETRDISLAGRILAQFPDVLTET
QRVSDDLAELGEMTASPDANIIKLPNISASMPQLKAAIKELQEQGYLLPDYPDEPKNSAQ
KDVKMRYDRVKGSAVNPVLREGNSDRRAPLSVKNYVRKYPHRMGAWSTTSKSHVAHMEGG
DFFGSERSAVLAQAGMLKVELIAKDGTVTVLKDKVAVSAGDIVDAAVLSKQALAVFVAAQ
MNDAKSQGVLFSVHLKATMMKVSDPVIFGVFVSEFYKEALAKHAGTLKQVGFDPNNGIGD
LYARIVALPEEIQAVIRADVQAQYAKRPGLAMVNSVKGITNLHVPSDVIVDASMPAMIRS
SGQMWNVAGTLQDTKAVIPDRCYAGVYKTVIDDCKLHGAFDPVTMGSVPNVGLMAQKAEE
YGSHDKTFQVQSGGVVRVSDDRGEVLFEHSVEVGDLWRMCQTKDAPIQDWVRLAVERARL
SHVPAVFWLDSARAHDVQVIAKVERYLKDHDTNGLDIRIMSPVAAMEFSLARIRKGQDTI
SVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQFTEENYL
RWDSLGEFLALAASLEHLGNRYDHVAAKVLAKALDVANGQILDNNKSPAREIGELDNRGS
HFYLALYWAQALAAQDEDVVLQVKFASLAKVLSEHEVTIVADLNAVQGSPVDIGGYYHPD
LARVAAGMQPSKTFNDALRLFSS
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtacgcccaagcttatttatacacttacagacgaggcgccgttcttggcaacg
cagtcgctattgccaattatcaaggcttacaccaaggttgctggtatccaggttgagaca
cgtgatatttctttggccgggcgtatcttggcgcagtttcctgatgtgttgaccgagacg
caaagagtcagtgacgatctggctgagttgggggaaatgacggctagtccggatgccaac
attattaagttgcctaatatcagtgcttcaatgccgcagttaaaggctgctatcaaagag
ttgcaggagcagggctatttgttgccggattatccggatgaaccaaaaaacagtgcgcaa
aaggatgtcaagatgcgctatgacagggtgaagggtagtgcggtcaatcccgtactgcgt
gaaggcaattctgatcgccgtgccccgttgtcagtgaagaattatgtgcgtaagtatccg
catcggatgggggcgtggagtactacatccaagtcgcatgtcgcacatatggagggcggt
gatttttttggtagtgaacgttcggctgtactcgctcaggctggtatgttgaaggtcgaa
ctgattgctaaggatggcacggtgacggtactcaaggataaggttgcagtgagtgccggt
gatattgtggatgctgcggtgctgagtaagcaggcattggctgtgtttgttgctgcacag
atgaatgatgcgaagtcacagggggtgctgttttcggtacacctgaaggcgacgatgatg
aaggtgtccgatccggtgatatttggggtgtttgtttcagagttctacaaagaggctttg
gccaagcatgctggcacgttgaaacaggtcggttttgatcctaacaatggtattggcgat
ttgtacgcacgcattgttgcgttgccggaggagatccaggcagtcatcagggctgatgtg
caggctcagtacgccaaacgtcctggtttggcgatggttaattctgtaaaggggatcact
aatttgcatgtgcctagtgatgtgattgtggatgcgtcgatgccggcgatgatccgtagt
tctggacagatgtggaacgttgcagggacgctccaagacactaaagcagtgattccggat
cgttgttatgccggcgtgtataaaactgtcattgatgattgcaagttacacggtgctttt
gatccagtgacgatgggttcggtgcccaatgtcggtttgatggcgcagaaggctgaggaa
tatggttcgcacgacaaaacgtttcaggtacagagtgggggtgtagtccgtgtcagtgat
gatcggggtgaggtgttgttcgagcattcggtagaggtgggtgatctttggcgcatgtgc
caaacgaaggatgcaccgatccaggattgggtcaggttggctgtggaacgtgcccgtctg
agtcatgttccggcagtgttctggttggacagcgcccgtgcgcatgatgtgcaggtgatt
gcaaaagttgagcgttatttaaaagatcacgataccaacggtttggatatacgtattatg
tcgccggtggcagcgatggaattttcgctggcccgcattcgtaaaggtcaggacacgatt
tcggtgaccggtaatgtgttgcgggattatttgaccgatttattcccaatcatggaattg
ggcaccagtgccaagatgctttccattgttccgttaatggcgggaggtggtttgtttgaa
actggtgccggtggttccgcgccgaagcatgtacagcaatttactgaggagaattacttg
cgttgggattcgttgggtgagtttctggcgttggctgcatcgttggagcatcttggtaac
cgctatgatcatgttgctgcaaaggtgttagcgaaagcgctggacgtggctaacggtcaa
attttggataacaacaaatctcctgcgcgtgaaatcggtgagttggataatcgtggtagc
catttttatctcgctttgtattgggctcaggcattagctgcacaggatgaggatgttgtg
ttgcaggttaagtttgcatctttggctaaagtgctgagtgagcatgaggtaaccatcgtt
gctgatctcaatgcggttcagggatctccagtggatattggtggttattatcatcctgat
ttggctagggttgctgctgggatgcagcctagtaagaccttcaacgatgcgttgaggttg
ttctcgagttga

DBGET integrated database retrieval system