KEGG   Xylella fastidiosa subsp. sandyi Ann-1: D934_02505Help
Entry
D934_02505        CDS       T03318                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
xfs  Xylella fastidiosa subsp. sandyi Ann-1
Pathway
xfs00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xfs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D934_02505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xfs01007]
    D934_02505
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xfs03016]
    D934_02505
Enzymes [BR:xfs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     D934_02505
Amino acid related enzymes [BR:xfs01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   D934_02505
Transfer RNA biogenesis [BR:xfs03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    D934_02505
 Prokaryotic Type
    D934_02505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1 tRNA-synt_1g tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIC09430
UniProt: A0A060H2C2
Position
complement(564605..566008)
Genome map
AA seq 467 aa AA seqDB search
MSLHLYNTLHRRVEPFEPLDPACPTMYVCGPTVYNYVHIGNARGPVVFGVLAALLRRRYG
ALRYARNITDVDDKINTAAQEQGVPISAITERFCAAYREDMKKLGVEPPDIEPEATAHMP
QIIAMIEQLIERQHAYVAMEHVLFAVNSFADYGQLSRRDPEEMLAGARVEIAPYKRDPSD
FVLWKPSSYQLPGWDSPWGRGRPGWHIECSAMAAAHLGETIDIHAGGIDLQFPHHENEIA
QSRCAHGSSTFARVWMHNGMLNFEGAKMSKSLGNIETVHELVAKHPPEALRYALLSAHYR
KPLDWSEALIAQSVRTLNRLYGTLRDLAAYPARAIIPGNIEAALDDDLNTPQALAELATL
ANEARIQLADTTHHEAAEVTTALTRLKAKLLGAGLALGLLQQTPEAWFSQGTNESDETHI
QALIDARSAAKQARDFVRADAIRAQLAAEGIVLEDTPQGVRWMKQHT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcacctttacaacacccttcaccggagagtcgagccgttcgaaccgctggac
cctgcctgcccaactatgtatgtatgcggtccgaccgtctacaactatgtgcatatcggc
aacgcccgcggtccagtcgtgtttggggtgttggccgcgctgctgcggcggcggtatggg
gcgctgcgctacgcacgcaacatcactgacgtggatgacaagatcaacactgctgcgcag
gagcagggtgttcccatctcggccattactgaacgcttctgcgctgcttaccgtgaggat
atgaaaaaactcggtgtggagccgcctgatatcgagccggaagccactgcgcatatgcca
cagatcatcgcgatgatcgaacagctgatcgaacgccagcatgcatatgtcgcgatggag
catgtgctgttcgcggtgaacagctttgccgattatgggcaactgtcgcgccgggatccg
gaagagatgttggccggtgctcgggtcgagatcgctccatacaagcgtgacccaagcgat
ttcgtgctgtggaaaccttccagctatcagcttcctggctgggactcgccctgggggcgc
ggtcgccccggctggcatattgagtgctccgcaatggccgctgcgcatctgggggagacg
attgatatccacgctggcggaatcgatctgcaattcccgcatcatgaaaatgaaatcgca
caaagtcgctgcgcacacggcagcagtacgttcgcacgggtctggatgcacaacgggatg
ctcaattttgaaggtgccaaaatgagcaaatcgctgggcaatatcgagaccgtgcatgag
ttggtggcaaagcatcctcccgaagcactacgttacgcgctgctttcggcacattatcgg
aaaccgctggactggtcagaggcactcatcgcacagtcggtacgcactctaaaccggctg
tatgggacgctgcgcgatttggcggcgtatccggcacgcgccatcatcccagggaatatc
gaagcagcgttggatgacgatctcaacacgccgcaggcgctggccgagttggcgacactg
gcaaacgaagcacgcatccaattggctgacaccacacatcacgaagcagccgaggtcact
accgcgctcacccggctgaaagccaagttgcttggcgccggtctggctcttggtctgctg
cagcaaacgccagaggcgtggttcagccaaggcaccaacgagagcgatgaaacgcatatc
caggcgctgattgatgcgcgcagtgcagccaagcaggcacgggattttgtccgtgccgac
gcaatccgtgcacaactcgccgcagagggtattgtgcttgaggatacaccgcagggggta
cgctggatgaagcagcacacgtag

DBGET integrated database retrieval system