KEGG   Xylella fastidiosa subsp. sandyi Ann-1: D934_05485Help
Entry
D934_05485        CDS       T03318                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
xfs  Xylella fastidiosa subsp. sandyi Ann-1
Brite
KEGG Orthology (KO) [BR:xfs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xfs03009]
    D934_05485 (rluD)
Enzymes [BR:xfs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     D934_05485 (rluD)
Ribosome biogenesis [BR:xfs03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    D934_05485 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AIC09855
UniProt: A0A060H3H1
Position
complement(1163178..1164182)
Genome map
AA seq 334 aa AA seqDB search
MFLLVFMSDDLAGLFSRQTTVPDGAAGRRFDAVLAELFPEFSRSRLTEWIKSGDVLLNGV
LVRPRDPVYGGEVVRLQVVPDIRTDAVPQDIPLDILYEDEHVFVINKPAGLVVHPGAGNP
DGTLVNALLHRDPALAAVPRAGVVHRLDKDTSGVMVVARTLQAQTALVEQLSSRQVHRQY
LAVVVSALVSGGTVNAAIERHPRDRLRMAVSDTGKEAVTHYRLRERFRAHTALECRLDTG
RTHQIRVHMAHLRHPIVGDRLYGGSLKLPKGGTDALVVMLRGFKRQALHAEVLEFLHPVG
ALPVRIVAPVPEDLCQLLAALREDSVLFFEREWR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttgttggtgtttatgtccgatgacctcgctggattattctcccgtcagaccact
gtgccggatggtgctgctggccgtcgtttcgatgctgtgttggctgagctttttccggaa
ttctcgcgctcgcgcttgacggaatggatcaaatctggggatgtgctgttgaatggagtg
ttggtacgaccgcgtgatccggtttacggtggcgaggtggttcggttgcaggtcgtgcca
gatatccgcactgatgcggtgccgcaggatattccgttagatattttgtacgaggatgag
catgtattcgtcatcaataagcctgcggggttggtcgtacacccgggggctggtaatccc
gatgggacgttggttaatgcgttgctgcatcgtgatccggcgttagcggcggtgccgcgt
gctggagtggtgcatcgtttggacaaggatacgagtggggtgatggtcgtggcacgcacg
ctgcaggcgcagactgcgttggtggagcagttgtcttcacgtcaggtacatcgtcagtat
ttggcagtcgttgttagcgcgttggtttccggtggtacggtgaatgcggcgattgaacgt
cacccgcgtgaccggctgcggatggcggtgtcagacacagggaaggaggcagtcactcat
tatcggttgcgggaacgtttccgtgcccatacggcattggagtgtcgtttagatactggg
cgtacgcatcagatccgtgtccacatggcgcatctgcgccatccaattgtcggtgatcgg
ttgtacggtgggtcgttgaagctgccaaagggcggcacggatgccttggtcgtcatgctg
cgtggattcaagcgtcaggcattgcatgctgaggtgttggagtttctgcatcctgtcggg
gctctgcctgtgcgtattgttgcgccggtgccagaggatttatgtcagcttcttgcggcg
ctgcgtgaggacagtgtgctgttctttgagcgggagtggcgttga

DBGET integrated database retrieval system