KEGG   Xylella fastidiosa subsp. sandyi Ann-1: D934_12525Help
Entry
D934_12525        CDS       T03318                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
xfs  Xylella fastidiosa subsp. sandyi Ann-1
Brite
KEGG Orthology (KO) [BR:xfs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    D934_12525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 N_BRCA1_IG LTD
Motif
Other DBs
NCBI-ProteinID: AIC10715
UniProt: A0A060H5W5
Position
2484873..2485256
Genome map
AA seq 127 aa AA seqDB search
MENNPNSKIEVAVSSRFLDQQSNRNEGRYVFAYTIRIYNAGNVPARLIARHWQITDANGK
VEYVTGEGVIGEQPRLRPGEEFRYTSGVVLGTEQGQMQGHYDMMADDGTEFTATISPFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaatcccaattcaaagattgaggtcgctgtctcgtcccgcttcctcgaccag
caatctaatcgtaatgaaggccgctacgtcttcgcctacaccatccggatctacaatgct
ggaaatgtccctgcacgactgatcgcgcgccactggcagattaccgatgcaaacggcaaa
gtcgaatacgtcactggtgaaggagtcattggagaacaaccacggctgcgtcccggcgaa
gaatttcgctacacctctggggtcgtgttgggaaccgaacagggccagatgcaaggacat
tacgacatgatggccgatgacggtaccgaattcaccgccacaatctccccattcgtactc
agtgtgccgcgaacactacactga

DBGET integrated database retrieval system