KEGG   Xylella fastidiosa Temecula1: PD_1980Help
Entry
PD_1980           CDS       T00113                                 

Gene name
phhB
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
xft00790  Folate biosynthesis
xft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xft00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PD_1980 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xft04147]
    PD_1980 (phhB)
Enzymes [BR:xft01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PD_1980 (phhB)
Exosome [BR:xft04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PD_1980 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AAO29809
UniProt: Q87A51
Position
2328245..2328595
Genome map
AA seq 116 aa AA seqDB search
MNDRITLAQAHCQPREKKEHKLGQARLAELLTQVPGWELSNNGHALTRTFQFDNYYRTLA
FVNALAFIAHCEDHHPDMNVHYGRAVVCFSTHKIGGISEIDFICAAKTSALYEQGI
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcggattactctagctcaagctcactgccagccgcgagaaaaaaaagaacac
aaactcggccaagcccgcttagccgaactgttgacacaagtcccaggatgggaattgagt
aataacggacatgcactcacccggacattccaattcgacaattattaccgtaccctcgca
ttcgttaacgcgctcgcttttatcgcacactgcgaagatcatcacccggacatgaacgtg
cactatggcagggctgtcgtgtgcttttcaacgcataaaatagggggaatcagcgagatt
gacttcatttgcgccgctaagacttccgccctatacgaacaaggaatctga

DBGET integrated database retrieval system