KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr02800Help
Entry
XFF4834R_chr02800 CDS       T03094                                 

Definition
(GenBank) putative amidase signature (AS) protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00970  Aminoacyl-tRNA biosynthesis
xfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XFF4834R_chr02800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xfu03029]
    XFF4834R_chr02800
Enzymes [BR:xfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     XFF4834R_chr02800
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     XFF4834R_chr02800
Mitochondrial biogenesis [BR:xfu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    XFF4834R_chr02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF4089
Motif
Other DBs
NCBI-ProteinID: CDF59954
UniProt: A0A2H1SC28
Position
complement(326338..327798)
Genome map
AA seq 486 aa AA seqDB search
MQLPAQWQAGVDRNTEVLRGHAQLLATFHAPPATAHDGSGSRGQIASIVSTTRSQPTLAA
RLATQTLTRINQANDRLCAITRLLPARAAADAARVQAALAGGSDGGALAGVPFVVKDLFD
VAGQVTTAGAAVRAHCPPASRDAAVVQRLGEAGAVLVGTANMDEFAYGFATVNAHYGTTA
NPHDDQHLAGGSSGGSAAAVAAGLVPFALGSDTNGSIRVPAALCGIYGLRPTHGAVPLDG
VFPFVDALDVVGPFATSVADLRHVYDVLRGQPLPACHAGKLRVARLGGWFERNLDPDLEA
GLQALLAACNSLLSIDLPEAERARAAAFVLTAAEGGHRHRGALTAHGAQFDPATRDRLLA
GLQLPASAVADAHRFAQWFADAMHALWDQVDVLIAPATPCVAPRIDQDTIQIDGLPVSAR
ANLGIFTQPLGLAACPVLAAPLPRPGRLPLGVQLIAAPGREDRLFALAAQLERDGLLAFS
PPPEPR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcccagcgcagtggcaggccggcgtcgatcgcaataccgaagtgctgcgcggg
cacgcgcagctgctggccaccttccatgcgccgcctgcaacggcgcatgatggcagcggt
tcgcgcggccagatcgcctccatcgtcagcaccacgcgcagccagcccacgctggccgcg
cgactggccacccagacgctgacacgcatcaaccaggccaacgaccgcctgtgcgccatt
acccgcctgctgccggcgcgtgccgcggccgatgccgcgcgcgtgcaggctgcgcttgcc
ggtggcagcgacggtggcgcgttggccggcgtgccgttcgtggtcaaggacctgttcgat
gtcgccgggcaggtcaccaccgccggcgccgcagtgcgtgcgcattgcccgcctgccagc
cgcgatgcggcggtggtgcaacggctcggcgaagccggcgccgtgttggtgggtaccgcc
aacatggacgaattcgcgtacggcttcgccacggtcaatgcgcattacggcaccaccgcc
aatccgcacgatgaccagcacctggcaggcggctcatcgggcggctcggcggcagcggtg
gccgccgggctggtgccgttcgcgcttggctcggacaccaacggctccatccgcgtgccg
gctgcgctgtgcggcatctacggcctgcgccccacccacggtgccgtgcccctggatggg
gtgtttccgtttgtcgatgcgctggatgtggtcggcccattcgccacctcggtggccgac
ctgcgccacgtgtacgacgtactgcgcgggcagccgctgcctgcgtgccatgccggcaag
ctgcgcgtcgcgcggttgggcggctggtttgaacgcaatctggatccggatctggaggcc
gggctgcaggccctgctcgccgcctgcaacagccttttgtcgatcgacctgcccgaggcc
gaacgcgcacgcgccgctgccttcgtcctgaccgctgccgaaggcgggcatcgtcaccgc
ggcgcgctcaccgcgcacggcgcgcagttcgacccggccacccgcgaccgcctgcttgcc
ggcttgcagctgcctgccagcgccgtggccgatgcgcaccgcttcgcgcagtggtttgcc
gatgccatgcacgcgctgtgggaccaggtggatgtgctcatcgcgccagccacaccctgc
gtggcgccacgcatcgaccaggacaccatccagatcgacggtttgcccgtctctgcgcgt
gcgaatctgggtattttcacccagccactcggcctggcggcctgcccggtgctggccgca
ccgctgccgcgtcccgggcgcctgccactgggcgtgcaactgatcgccgcgcccggccgt
gaggaccgcctgtttgcgctggccgcgcaactcgagcgcgacggcctgctcgccttcagc
ccaccgccggagccacgctga

DBGET integrated database retrieval system