KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr25680Help
Entry
XFF4834R_chr25680 CDS       T03094                                 

Definition
(GenBank) Putative ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00040  Pentose and glucuronate interconversions
xfu00053  Ascorbate and aldarate metabolism
xfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XFF4834R_chr25680
   00053 Ascorbate and aldarate metabolism
    XFF4834R_chr25680
Enzymes [BR:xfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     XFF4834R_chr25680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CDF62068
UniProt: A0A2H1SG43
Position
complement(2977536..2979152)
Genome map
AA seq 538 aa AA seqDB search
MNDTNHSISAAAAEILLAGRWQASRAATGSFRAADPATGEPIGHYFPVSGADDVEAAVVA
AQAVAAELAAAPVERIAAFLEGYADALDADADTLVALAHAETALPAPTRLRGNELPRTSG
QLRQAARAVRSYSWTQPIIDSAADLRSHLAPLGKPVLVFGPNNFPFAFNAIAGSDFASAI
AARNPVIAKAHPLHPATSQRMAQLAHQALVAAGLPAGAVQLLYHFDNAIGLRLAGDARLG
AIAFTGSRAGGLALKAAADAAGVPFYAELSSVNPVFLLPGALAERGDALAQEFFASCTLG
SGQFCTNPGVVVVPHGAAGDAFVAATKAHFEAAMPMVLFSASGVEGVQRGVASLRAAGAG
MLAGGHTGEDGYRYAPTLLSVDAQAFLANPHALQVEAFGPVSLLVRAADVAQMAQVAAAF
EGNLTGTLYRAADGRDDAAWQTIAPVLRARVGRLINSKMPTGVAVSAAQNHGGPFPSTGH
PGFTAVGMPGAIRRFAALHSYDAVPDALLPAELRQRNPGGVARLVDGQWSTADLGAGA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatacgaaccactccatttccgcggcagcagccgagatcctgctggcaggccga
tggcaagccagccgcgccgccaccggcagcttccgtgctgccgacccggccaccggcgaa
ccgatcgggcactactttccggtcagtggcgcggacgatgtggaagcggccgtggttgcg
gcgcaggcagtggcggcggagttggcggccgcaccggtggagcggatcgcggcctttctg
gaaggctatgccgatgcgctggatgccgatgccgataccctggtcgcgctggcgcatgcc
gagacggcgttaccggcgcccacacgcttgcgcggtaacgaactgccgcgcaccagcggc
caactgcggcaggccgcacgggccgtgcgcagctacagctggacccagcccatcatcgac
agcgcggccgatctgcgttcgcacctggcgccgctgggcaagccggtgctggtgttcggc
ccgaacaactttccgttcgcgttcaatgcaattgccggcagcgatttcgcctcggcgatt
gccgcgcgcaacccggtcatcgccaaggcgcatccgttgcatccggccaccagccagcgc
atggcgcagctcgcgcatcaggccttggtcgcggccggtctgcctgcgggggcggtgcaa
ctgctgtatcacttcgacaatgccatcggcctgcgattggcgggcgacgcgcggctgggc
gcgatcgcattcactggcagccgtgccggtgggctggcactgaaggccgccgcagacgcg
gcgggcgtaccgttttatgccgaactttccagcgtcaacccggtcttcctgttgccgggc
gcgctggccgagcgcggtgatgcgcttgcgcaggaattcttcgcctcctgcacgctgggt
agcgggcagttctgcaccaatcccggtgtggtggtggtgccgcatggcgcggctggcgat
gcgttcgtagcggccaccaaggcgcattttgaagcggccatgccgatggtgctgttctcc
gcctctggtgtagaaggcgtgcaacgcggtgtggcgagcctgcgtgccgccggcgccggc
atgctggccggcgggcacaccggcgaggatggctaccgctatgcgccgaccttgttgagt
gtggatgcacaagccttcctcgccaacccgcacgccctgcaggtcgaagccttcgggcct
gtgagcctgctggtgcgcgcagccgatgtggcgcagatggcacaggtggctgctgcgttc
gaaggcaacctgaccggcacgttgtaccgcgcggccgacggccgcgacgatgccgcgtgg
cagaccatcgccccggtattgcgcgcgcgggtcgggcgcttgatcaacagcaagatgccg
accggcgtggccgtgagcgccgcgcaaaaccacggtggcccgttcccgagcaccgggcat
ccgggcttcacggcagtgggcatgcccggcgccatccgccgttttgccgccttgcacagt
tacgacgcggtgcccgatgcactgctgccggccgaactgcgccagcgcaatccgggcggc
gtggcacgtttggtcgacgggcaatggagcacggccgatcttggagccggcgcatga

DBGET integrated database retrieval system