KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr29170Help
Entry
XFF4834R_chr29170 CDS       T03094                                 

Definition
(GenBank) putative 5-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00230  Purine metabolism
xfu00240  Pyrimidine metabolism
xfu00760  Nicotinate and nicotinamide metabolism
xfu01100  Metabolic pathways
xfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XFF4834R_chr29170
   00240 Pyrimidine metabolism
    XFF4834R_chr29170
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    XFF4834R_chr29170
Enzymes [BR:xfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     XFF4834R_chr29170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-ProteinID: CDF62383
UniProt: A0A2H1SWD5
Position
complement(3352737..3353693)
Genome map
AA seq 318 aa AA seqDB search
MPDNSPRLLTVAVTSRALFDLEEGHALFEADGVEAYSAFQREHEDDILQPGVAFPVVRKL
LALNHDVPEDAPRVEVILLSRNSADTGLRIFNSIQHYNLGIVRATFTSGEPTWPYVKPFG
TDLFLSANPESVRRALSHGIAAATIMPRALGERAEAAAAIVDNDESRLSTQLRIAFDGDA
VIFGDESERISREQGVEAFGRHERERAREPLSVGPFRNFLSALHTLQAAFPPGQASPIRT
ALVTARSAPAHERVIRTLREWGVRLDEALFLGGRHKGPFLQAFGADIFFDDSQHNIDSAR
QHQHVAAGHVPHGVANEG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaactccccaaggttattgaccgtcgcggtgacctcgcgcgccctgttcgat
ctcgaagaaggccatgccctgttcgaggccgacggagtggaggcgtattcggcgttccag
cgcgagcatgaggacgacatcctgcaacctggcgtcgcgttcccggtggtgcgcaagctg
ctggcgctcaatcacgatgtgcccgaggacgcgccgcgggtggaagtcatcctgctgtca
cgcaattccgccgataccggtctgcgcatcttcaactcgatccagcattacaacctgggc
atcgtgcgtgccaccttcacctcgggcgagccgacctggccctatgtcaagccattcggg
accgatctgttcctgtcggccaatccggaatcggtgcgccgcgcgctgagccatggcatc
gcggcggcgaccatcatgccgcgcgcactgggcgaacgcgccgaggctgccgcggcaatc
gtggacaacgacgaaagccggctgtcgacgcagctgcggattgccttcgatggcgatgcg
gtgatcttcggcgacgagagcgaacggatctcgcgcgagcagggcgtggaagccttcggg
cgtcacgagcgcgaacgcgcgcgcgagccgttgtcggtggggccgttccgtaacttcctg
tcggcgctgcataccttgcaggcggcctttccgcccggccaggcctcgccgatccgcacg
gcgctggtcaccgcgcgctcggcaccggcgcatgagcgggtgatccgcacgttgcgcgag
tggggcgtgcgtctggacgaggcgctgttccttggcgggcgtcacaagggcccgttcctt
caggcgtttggtgcggatatcttcttcgacgactcgcagcacaacatcgacagtgctcgc
cagcatcagcatgtggccgccggccatgtgccgcacggtgtggccaacgaagggtaa

DBGET integrated database retrieval system