KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr31140Help
Entry
XFF4834R_chr31140 CDS       T03094                                 

Gene name
metG
Definition
(GenBank) probable methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00450  Selenocompound metabolism
xfu00970  Aminoacyl-tRNA biosynthesis
xfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XFF4834R_chr31140 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XFF4834R_chr31140 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xfu01007]
    XFF4834R_chr31140 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xfu03016]
    XFF4834R_chr31140 (metG)
Enzymes [BR:xfu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XFF4834R_chr31140 (metG)
Amino acid related enzymes [BR:xfu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XFF4834R_chr31140 (metG)
Transfer RNA biogenesis [BR:xfu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XFF4834R_chr31140 (metG)
 Prokaryotic type
   Other AARSs
    XFF4834R_chr31140 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CDF62567
UniProt: A0A2H1S615
Position
3583671..3585755
Genome map
AA seq 694 aa AA seqDB search
MTRTALVTTALPYANGPLHLGHLVGYIQADIWVRARRLRGDKTWFVCADDTHGTPIMLAA
EKAGVTPEAFIANVQASHERDFAAFGVTFDHYDSTNSPVNRELTEAFYAKLDAAGHISRR
SVAQFYDTAKGMFLPDRYIKGICPNCGSADQYGDNCEVCGATYAPTELKEPRSVISGAKP
ELRDSEHFFFEVGHFDGFLRQWLAGDVALPGVKAKLKEWLDAEGGLRAWDISRDAPYFGF
QIPGQPGKYFYVWLDAPIGYLCSFKTLCAQMGEDFDAHLVAGTQTELHHFIGKDIVNFHG
LFWPAVLHGTGHRAPTRLHVNGYLTVDGAKMSKSRGTFVMARTFLDVGLEPEALRYYFAA
KSSGGVDDLDLNLGDFIARVNADLVGKFVNLASRCAGFIGKRFDGKLADALPDAAQYDRF
VAALAPIREAYERNDAASAIRQTMALADEANKYIDDTKPWVIAKQDGADAQLQSVCTQGL
NLFRILVAALKPILPRTCAEAEAFLSAPMTSWEDVIGPLTAHTIQPYTALFTRIDPKLID
AMTDASKDTLAAPAAPATTTKPAPSKADAKPAAVANPESQTTNPGLIGIDDFAKLDLRIG
KVLVCEFVEGSDKLLRFELDAGELGTRQIFSGIRASYGEPETLVGRSVVFIANLAPRKMR
FGISEGMILSAGFDGSALALLDADSGAQPGMPVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccgcactcgtcactaccgccctgccgtatgccaacggcccgctgcatctt
ggccacttggtcggctacatccaggccgatatctgggtgcgcgcacgccggttgcgcggc
gacaagacctggttcgtctgtgccgacgacacccatggcacgccgatcatgctggctgcc
gagaaggccggggtgaccccggaagccttcatcgccaacgtccaggccagccacgagcgc
gatttcgcggcgttcggagtgaccttcgaccactacgattcgaccaattcgccggtcaat
cgcgagctcaccgaagccttctacgccaagctcgatgctgccggccacatcagccggcgc
tcggtggcgcagttctacgatacggccaagggcatgttcctgccggaccgctacatcaag
ggcatctgtcccaactgcggcagcgccgaccagtacggcgacaactgcgaggtctgcggc
gctacctacgcgccgaccgagctgaaggagcccaggtcggtgatctccggcgccaagccc
gaactgcgcgattcggagcatttcttcttcgaagtgggccatttcgacggcttcctgcgg
cagtggcttgccggcgatgtggcgctgcccggggtcaaggccaagctcaaggaatggctg
gacgccgaaggcggcctgcgcgcctgggacatctcgcgcgatgcgccgtatttcggcttc
cagattcccggccagccgggcaagtatttctacgtgtggctggacgcgccgatcggctac
ctgtgcagcttcaagacgctgtgcgcgcagatgggcgaagacttcgatgcgcatctggtg
gccggcacgcagaccgagctgcatcacttcatcggcaaggacatcgtcaatttccacggc
ctgttctggccggcggtgctgcacggcaccggccaccgcgcgccgacccggctgcacgtc
aacggctacctcaccgtggacggcgccaagatgtccaagtcgcgcggcaccttcgtgatg
gcgcggaccttcctggatgtcggcctggaaccggaagcgctgcgttactacttcgcggcc
aagtcttccggcggcgtggacgaccttgacctcaacctgggcgatttcatcgcacgggtg
aatgcggacctggtcggcaagttcgtcaacctggccagccgctgcgccggcttcatcggc
aagcgcttcgacggcaagctggccgacgcactacccgatgccgcccagtacgaccgcttc
gtcgccgccctggcaccgatccgcgaggcctacgaacgcaacgatgccgccagcgcgatc
cgccagaccatggcactggccgacgaggccaataaatacatcgacgacaccaaaccgtgg
gtgatcgccaagcaggatggcgccgatgcgcagctgcagtcggtctgcacgcagggcctg
aacctgttccgcatcctggtggccgcgctcaagccgatcctgccgcgcacctgcgccgaa
gccgaggccttcctgtcggcgccgatgaccagttgggaagacgtgatcggcccgctgaca
gcgcacacgatccagccctacaccgccctgtttacccgtatcgaccccaaactgatcgac
gccatgaccgacgcttccaaggacaccctcgccgcacccgcagcaccagccaccaccacc
aagcccgcaccgagcaaggctgacgcaaagcctgccgccgttgcgaatcccgaatcccaa
accaccaatcccggcctcatcggtatcgacgatttcgccaagctcgacctgcgcatcggc
aaggtgctggtgtgcgaattcgtggaaggctcggacaagttgctgcgtttcgaactggac
gccggcgaactgggcacgcggcagatcttctccggcattcgcgccagctacggcgaaccg
gagacgctggtcggccgcagcgtggtgttcattgccaacctggccccgcgcaagatgcgc
tttggcatcagcgaaggcatgatcttgtcggctggcttcgacggcagcgccctggcgctg
ctggacgccgacagcggcgcacagccgggcatgccggtcaggtga

DBGET integrated database retrieval system