KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr31520Help
Entry
XFF4834R_chr31520 CDS       T03094                                 

Gene name
atoB
Definition
(GenBank) probable acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00071  Fatty acid degradation
xfu00072  Synthesis and degradation of ketone bodies
xfu00280  Valine, leucine and isoleucine degradation
xfu00310  Lysine degradation
xfu00362  Benzoate degradation
xfu00380  Tryptophan metabolism
xfu00620  Pyruvate metabolism
xfu00630  Glyoxylate and dicarboxylate metabolism
xfu00640  Propanoate metabolism
xfu00650  Butanoate metabolism
xfu00900  Terpenoid backbone biosynthesis
xfu01100  Metabolic pathways
xfu01110  Biosynthesis of secondary metabolites
xfu01120  Microbial metabolism in diverse environments
xfu01130  Biosynthesis of antibiotics
xfu01200  Carbon metabolism
xfu01212  Fatty acid metabolism
xfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XFF4834R_chr31520 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    XFF4834R_chr31520 (atoB)
   00640 Propanoate metabolism
    XFF4834R_chr31520 (atoB)
   00650 Butanoate metabolism
    XFF4834R_chr31520 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XFF4834R_chr31520 (atoB)
   00072 Synthesis and degradation of ketone bodies
    XFF4834R_chr31520 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XFF4834R_chr31520 (atoB)
   00310 Lysine degradation
    XFF4834R_chr31520 (atoB)
   00380 Tryptophan metabolism
    XFF4834R_chr31520 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XFF4834R_chr31520 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XFF4834R_chr31520 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XFF4834R_chr31520 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xfu04147]
    XFF4834R_chr31520 (atoB)
Enzymes [BR:xfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XFF4834R_chr31520 (atoB)
Exosome [BR:xfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XFF4834R_chr31520 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDF62605
UniProt: A0A2H1S662
Position
3621398..3622573
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNAVPAPTLAAAAIQGALAQSGIAPADISEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAQAAQRSGAFAEEIVPVTVATRKGEVVVDSDEQPGKSDVAKIPTLKPAFKKDGSV
TAASSSSISDGAAITVLMSADDAQRRGLTPLARIVGHVTHAQEPEWFTTAPVAAIQSLVS
KLGWRLDDVDLFEINEAFAVVAMAPISQLGIAHDKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgtactgccatcggctcgttcctcggccaa
ttcaatgcggtgccggcacccacgctcgccgcggctgctatccagggcgcactcgcgcaa
tcgggcatcgcgcctgccgatatttccgaagtcatcgtcggctgcgtgctgccggccaat
ctgggccaggcacctgcgcgtcaggccgcgatcgccgcaggcattcctacctcgaccggc
gccaccaccatcaacaaggtgtgcggctcgggcatgaaggcgatcatgttggggcacgac
ctgatcaaggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gccccgcatctgctgcccaactcgcgcaccggcaaccgctacggcaattttcaggccgtc
gatcacatggcctgggacggtctgaccaatccgtatgacggccaggccatgggcgtgttc
ggcgaagccactgcggagaagttcggcttcagccgcgccgaccaggatgcgttcgccatc
gcctcggtggaacgcgcgcaggcggcgcagcgcagcggcgcgtttgccgaggaaatcgtg
ccggtgacggtggccacgcgcaagggcgaagtcgtcgtcgacagcgatgagcagccgggt
aagtccgacgtggccaagattccgacgctgaagccggccttcaagaaagacggcagcgtg
accgcggccagttcctcgagtatttccgatggcgcggcaatcaccgtgctaatgagcgcg
gacgacgcgcaacgccgcggcctgacgccgctggcacgcattgttggccatgtcacccat
gctcaggaaccggagtggttcaccaccgcaccggtcgctgcgatccagtcgctggtcagc
aagctcggctggcgattggacgatgtggatctgttcgaaatcaacgaagccttcgccgtc
gtggcgatggcaccgatcagccaactcggcatcgcgcacgataaggtcaatgtgcatggc
ggcgcctgcgcattgggtcatccgatcggtgcatccggcgcgcgcttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcaagcgcggaatcgccacgctgtgcatcggcggc
ggcgaagccactgccattgctatcgaattgatttaa

DBGET integrated database retrieval system