KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr35020Help
Entry
XFF4834R_chr35020 CDS       T03094                                 

Definition
(GenBank) putative maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00350  Tyrosine metabolism
xfu00643  Styrene degradation
xfu01100  Metabolic pathways
xfu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    XFF4834R_chr35020
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    XFF4834R_chr35020
Enzymes [BR:xfu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     XFF4834R_chr35020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Tom37 GST_N_4 GST_C
Motif
Other DBs
NCBI-ProteinID: CDF62932
UniProt: A0A3T0F0T7
Position
complement(4065057..4065719)
Genome map
AA seq 220 aa AA seqDB search
MSAALELFSYWRSSAAYRVRIGLGLKALDYIAHPVHLVRDGGEQHAPAYAQLNPQELVPT
LRHGAVVIAQSLAILEYLEEAFADTTALLPRAPEERARVRALAQLIACDVHPLNNLRVLQ
ALEREFALEGAQRQQWTRLWMARGFTALETQLARDAQTGRFCHGDVPGLADCVLIPQLYN
AHRFEVDLVPYPTLRRIEQACLQLPAFDAARPEMQADAVA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggccctggaactgttttcgtactggcgctcgagcgcggcctatcgcgtgcgc
atcggtctggggctgaaggcgctggactacatcgctcacccggtgcatctggtgcgtgac
gggggcgagcagcacgcgcctgcctatgcgcaactcaatccgcaggaactggtgccgacg
ttgcggcatggcgctgtggtgatcgcgcagtcgctggcgattctggagtatctggaagag
gcatttgcggacaccacggcgttgctgccgcgcgcgcctgaagaacgcgcccgggtgcgc
gcactggcgcagctcatcgcctgcgatgtgcacccgctcaacaacctgcgcgtcctgcag
gcgctggagcgcgagttcgcgctggagggcgcacaacgccagcagtggacacggctctgg
atggcgcgtggctttacggcactggaaacgcagctggcgcgtgatgcgcagaccgggcgc
ttctgccacggcgatgtaccgggcctggccgattgcgtgctgattccgcagctctacaac
gcgcaccgtttcgaggtggatctggtgccatatccgaccctgcggcgcatcgagcaggcc
tgcctgcagttgccggccttcgatgcggcgcgcccggagatgcaggccgacgcggtggcc
tga

DBGET integrated database retrieval system