KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr37580Help
Entry
XFF4834R_chr37580 CDS       T03094                                 

Gene name
bglX1
Definition
(GenBank) putative beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00460  Cyanoamino acid metabolism
xfu00500  Starch and sucrose metabolism
xfu01100  Metabolic pathways
xfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XFF4834R_chr37580 (bglX1)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    XFF4834R_chr37580 (bglX1)
Enzymes [BR:xfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     XFF4834R_chr37580 (bglX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like PKD
Motif
Other DBs
NCBI-ProteinID: CDF63175
UniProt: A0A2H1SFI1
Position
complement(4343703..4345874)
Genome map
AA seq 723 aa AA seqDB search
MAADRIETLIARMTVEEKVGQLGVFADMVRPFAPDVNPEANVLNADEVLQQVRLGRVGSL
FNGVGAALGVQIQKVAVEESRLGIPVILAADVIHGMRTVFPIPLGEAASFEPALAERTAR
ATAIEATAAGLHWTYAPAVDIARDQRWGRGAEGAGEDVMLGAAFAAARVRGFQGSDLTAH
DCLLATPKHFAAYGAVAAGMEYNTVDIAPQTLRDVHLPPFKAAFDAGALTVMSSFNDING
VPASANHELLTQILRGEWQFPGVVISDYTADMELIAHGYAADERDATKKAFLAGLDLSMQ
SGFYAAHLPSLVESGEVPMATLDASVRRILQLKEAIGLFDNPYRSLDPAREADTTHLPAH
DALSRDAARRSIVLLKNEGGVLPLKKSGQRIALIGPFVQDRENIEGCWTLFGDKERYVTL
EQGVRAVVGTEDLSVVAGCGLEEALPGGISAAIDAAQAADVVVLALGEPQRFSGEAQSRT
EITLPPAQQALAEAIAATGTPMVVLLRNGRALALSGAVRDADAIAVTWYLGTQTGTGVAD
VLFGDYNPSARLPISFPQVTGQQPYFYNHLRTGRPELPTLSEYKARWREMPNEPLYPFGH
GLSYTTFAYAQPQLSAAQLGWDEALTITTRVSNTGKVAGEEVVQLYVHDRVASRVRPVRE
LKGFRKVLLQPGESQDVVFTLERDALAFTNHKGVFGAEPGLFDIWVCASAKSGEAVTFEL
LER
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgatcgcatcgaaaccctgattgcccggatgaccgtcgaagagaaggtcgga
cagttgggtgtgttcgccgacatggtgcggccgttcgcgccggacgtgaatcccgaggcc
aatgtgctcaatgccgacgaggtgttgcagcaggtgcgcttgggtcgggtcggctcgctg
ttcaatggcgtgggcgccgcgctgggcgtgcagatccagaaagtcgccgtggaagagagc
cgtctgggcatcccggtgatcctggccgccgacgtgatccacggcatgcgcacggtgttc
ccgattccgctgggcgaggcggccagtttcgagccggcgttggccgagcgcaccgcgcgc
gccaccgcgatcgaggccaccgctgccggcctgcactggacctacgcgccggccgtggac
atcgcgcgcgaccagcgctggggccgtggtgccgagggtgccggcgaagacgtgatgctg
ggcgcggcctttgccgctgcccgtgtgcgcgggttccagggcagcgacctgaccgcccac
gattgcctgctggccacgcccaagcatttcgccgcctatggcgcagtggcggcaggcatg
gaatacaacaccgtcgacattgcgccgcagaccttgcgcgatgtgcacttgccgccgttc
aaggccgccttcgatgccggcgcgttgaccgtgatgtcgtccttcaacgacatcaacggc
gtgccggccagcgccaaccacgagttgctgacgcagatcctgcgcggcgaatggcagttc
cccggcgtggtgatttccgattacaccgccgacatggaattgatcgcgcacggctatgcc
gccgatgagcgcgacgcgaccaagaaggccttcctggccgggttggacctgagcatgcaa
agcggcttttatgccgcgcatctgccgtcgctggtggaaagcggcgaggtgccgatggcc
acgttggatgccagcgtgcggcgcatcctgcagctcaaagaagcgatcgggctgttcgac
aatccgtatcgctcgctggacccggcgcgcgaagccgacaccacgcatctgccggcgcac
gatgcgttgtcgcgcgatgccgcgcggcgctcgatcgtgctgttgaaaaacgaaggcggc
gtgttgccgctgaagaagagcggccagcgcatcgcgttgatcggcccgttcgtgcaggac
cgcgaaaacatcgagggctgctggaccctgttcggcgacaaggaacgctacgtgaccctg
gagcagggcgtgcgtgcggtggtcggcaccgaggatctgagcgtggtggcgggctgcgga
ctggaagaggcgctgccgggtggcatttccgctgcgatcgatgcggcgcaggcggccgat
gtggtggtgctggcgttgggcgagccgcagcgtttcagtggcgaggcgcaatcgcgcacc
gagatcaccttgccgccggcgcaacaggcactggctgaagcgattgcagcgaccggcacc
ccgatggtggtgttgttgcgcaatggccgcgcgctggccttgagtggtgcggtgcgcgat
gccgacgcgattgccgtgacctggtacctgggcacgcagaccgggaccggtgtggccgat
gtgttgttcggcgactacaacccgtcggcgcgtctgccgatcagcttcccgcaggtgacc
gggcagcagccgtacttctataaccatctgcgcaccggccgcccggaattgccgaccctg
tccgaatacaaggcgcgttggcgcgagatgcccaacgagccgttgtatccgttcgggcat
ggcttgagctacaccacgtttgcgtatgcgcagccgcagttgagcgcagcgcaactcggc
tgggatgaggcgctgaccatcaccacgcgcgtcagcaacaccggcaaggtggcaggcgag
gaagtggtgcagttgtatgtgcacgatcgcgtggccagtcgcgtgcgcccggtgcgcgaa
ctcaaggggtttcgcaaggtattgctgcagcccggcgagagccaggacgtggtgttcacg
ctggagcgcgatgcgctggccttcaccaaccacaagggcgtcttcggtgcggagccgggt
ctgttcgatatatgggtgtgcgcgtcggccaagagcggcgaggcagtgaccttcgaactg
ctggaacgctga

DBGET integrated database retrieval system