KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr38750Help
Entry
XFF4834R_chr38750 CDS       T03094                                 

Gene name
argI
Definition
(GenBank) probable arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00220  Arginine biosynthesis
xfu00330  Arginine and proline metabolism
xfu01100  Metabolic pathways
xfu01110  Biosynthesis of secondary metabolites
xfu01130  Biosynthesis of antibiotics
xfu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    XFF4834R_chr38750 (argI)
   00330 Arginine and proline metabolism
    XFF4834R_chr38750 (argI)
Enzymes [BR:xfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XFF4834R_chr38750 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CDF63281
UniProt: A0A2H1SAU9
Position
complement(4467377..4468300)
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGDHCLGIGAITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPEALTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccctgattggcgtacccaccgacatcggcgcgggc
catcgcggtgcgcgcatggggccggaggcgctacgcatcgccggcctgcaggaggcgctg
gtcggccgcggcgtagaggtgcgcgatctgggcaatctggatggtccgcgcaatccctgg
caggcgccgcaggcaggctaccggcatctggacgaagtggtggcgtggaaccaggcgctg
atggacgccagctacgccgaactgcgtgccgggcgcatgccgatcatgctcggtggcgac
cattgcctgggcatcggcgcgatcacggcggtggccaagtactgccgcgagcagggcagg
ccgttgcgggtgctgtggctggatgcgcattcggatttcaacaccagcgaggtgacccct
tcgggcaacgtgcacggcatgccggtggcctgcctgtgcgggctgggccccgaggcgctg
acgcacctgggcggcagtgcgccggcgttgttgcccgagcaggtgcggcagatcggcatc
cgttcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtgtacgac
atgcgctacatcgacgaagccgggatgaagcgcaccatggaagcggcattgcagggcatg
agcgccgatacgcacctgcacgtgagtttcgacgtggacttcctcgaccccagcatcgcg
ccgggcgtgggcaccacggtgcccggtggccccaactaccgcgaggcgcaactggtgatg
gagatgattgccgacaccgggcgcatggggtcgttggatatcgtcgaactcaacccggtg
ctggacaaccgtaacgcgaccgccgagctggcggtggatctggtcgaaagcctgttcgga
aagtcgacgctgatgcgggattga

DBGET integrated database retrieval system